PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc03145.1.g00060.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 185aa MW: 20868.9 Da PI: 9.337 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.8 | 2.5e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l + ++++G g+W+t+++ g+ R++k+c++rw +yl Zmw_sc03145.1.g00060.1.am.mk 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 47.6 | 3.9e-15 | 67 | 109 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg++++eE++l++++++ lG++ W+ I+ +++ gRt++++k+ w+ Zmw_sc03145.1.g00060.1.am.mk 67 RGAFSQEEEDLIIELHAVLGNR-WSQISTRLP-GRTDNEIKNLWN 109 89********************.*********.*********998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.3E-28 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.396 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.87E-30 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.5E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.31E-11 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.63 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.0E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.0E-14 | 67 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.77E-9 | 69 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY 60 LRPDLKRGAF SQEEEDLIIE LHAVLGNRWS QISTRLPGRT DNEIKNLWNS SIKKKLRQKG 120 IDPNTHKPLA EVEHSKAAPT ISTERTSESS DFDPSIGGAI GNLNHIMSET AQSPELLPVL 180 AVVLQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-30 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021313187.1 | 1e-126 | transcription factor MYB61 isoform X2 | ||||
Swissprot | Q8VZQ2 | 1e-90 | MYB61_ARATH; Transcription factor MYB61 | ||||
TrEMBL | A0A0C6WCR2 | 1e-125 | A0A0C6WCR2_9POAL; ScMYB11 protein | ||||
TrEMBL | A0A1W0VX68 | 1e-125 | A0A1W0VX68_SORBI; Uncharacterized protein | ||||
STRING | Sb03g011640.1 | 1e-125 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2310 | 37 | 94 |
Publications ? help Back to Top | |||
---|---|---|---|
|