PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03145.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 185aa    MW: 20868.9 Da    PI: 9.337
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03145.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
  Zmw_sc03145.1.g00060.1.am.mk 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61
                                  678*******************************************97 PP

2Myb_DNA-binding47.63.9e-1567109145
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   rg++++eE++l++++++ lG++ W+ I+ +++ gRt++++k+ w+
  Zmw_sc03145.1.g00060.1.am.mk  67 RGAFSQEEEDLIIELHAVLGNR-WSQISTRLP-GRTDNEIKNLWN 109
                                   89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.396961IPR017930Myb domain
SuperFamilySSF466894.87E-3012108IPR009057Homeodomain-like
SMARTSM007176.5E-121363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001677.31E-111761No hitNo description
PROSITE profilePS5129424.6362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2565116IPR009057Homeodomain-like
SMARTSM007176.0E-1366114IPR001005SANT/Myb domain
PfamPF002496.0E-1467109IPR001005SANT/Myb domain
CDDcd001671.77E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIE LHAVLGNRWS QISTRLPGRT DNEIKNLWNS SIKKKLRQKG  120
IDPNTHKPLA EVEHSKAAPT ISTERTSESS DFDPSIGGAI GNLNHIMSET AQSPELLPVL  180
AVVLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-30121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021313187.11e-126transcription factor MYB61 isoform X2
SwissprotQ8VZQ21e-90MYB61_ARATH; Transcription factor MYB61
TrEMBLA0A0C6WCR21e-125A0A0C6WCR2_9POAL; ScMYB11 protein
TrEMBLA0A1W0VX681e-125A0A1W0VX68_SORBI; Uncharacterized protein
STRINGSb03g011640.11e-125(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Matías-Hernández L, et al.
    AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.
    Plant J., 2017. 90(3): p. 520-534
    [PMID:28207974]