PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02673.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 87aa    MW: 9563.55 Da    PI: 6.0586
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02673.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY45.71.3e-1410462359
                                  EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                                  +YYrC+  gC++kk+ve++ ed+++v++tY g Hnh 
  Zmw_sc02673.1.g00030.1.sm.mk 10 NYYRCSADGCSMKKRVEQDCEDTRYVITTYDGVHNHA 46
                                  6***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007741.2E-7447IPR003657WRKY domain
PROSITE profilePS5081115.7781048IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-131048IPR003657WRKY domain
PfamPF031063.8E-101045IPR003657WRKY domain
SuperFamilySSF1182904.58E-121048IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MEILDDGFWN YYRCSADGCS MKKRVEQDCE DTRYVITTYD GVHNHASPAA ATIMQYGGGT  60
RAHGFYSLPH NGSPLAATSY SSGSLLF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001309782.13e-31uncharacterized protein LOC107546771
RefseqXP_020394763.13e-31uncharacterized protein LOC107546771 isoform X2
SwissprotQ93WU92e-14WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLC4J6I07e-30C4J6I0_MAIZE; Putative WRKY transcription factor 50
STRINGGRMZM2G163054_P041e-30(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4430833
Publications ? help Back to Top
  1. Yan C, et al.
    Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis.
    Mol. Cell, 2018. 70(1): p. 136-149.e7
    [PMID:29625034]