PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc02493.1.g00070.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 129aa MW: 14793.6 Da PI: 8.0569 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 144.5 | 2.5e-45 | 3 | 96 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 ++qd++lPianv+rimk vlP +akisk aket+qec +ef++fvt+eas++c+r++rktingdd+++a+ +lG+++y+++++ Zmw_sc02493.1.g00070.1.am.mk 3 SAQDNLLPIANVGRIMKDVLPPQAKISKSAKETIQECTTEFVGFVTGEASERCRRDRRKTINGDDICHAMRSLGLDHYADAMR 85 579******************************************************************************** PP NF-YB 85 vylkkyreleg 95 yl++yre e+ Zmw_sc02493.1.g00070.1.am.mk 86 RYLQRYRESEE 96 ********885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.1E-41 | 3 | 99 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.48E-33 | 5 | 97 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-24 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.1E-14 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 4.1E-14 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 4.1E-14 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MNSAQDNLLP IANVGRIMKD VLPPQAKISK SAKETIQECT TEFVGFVTGE ASERCRRDRR 60 KTINGDDICH AMRSLGLDHY ADAMRRYLQR YRESEELAAA FNRTSGREIQ IDVRDELSIF 120 RGSEQRQDK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-37 | 5 | 93 | 4 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-37 | 5 | 93 | 4 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001266909.1 | 2e-73 | uncharacterized protein LOC101027253 | ||||
Swissprot | O04027 | 2e-42 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A2T7DBX6 | 4e-73 | A0A2T7DBX6_9POAL; Uncharacterized protein | ||||
STRING | GRMZM2G169884_P01 | 7e-73 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|