PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02280.1.g00020.1
Organism
Zoysia matrella
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 151aa    MW: 17270.9 Da    PI: 9.9683
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02280.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.56.5e-27959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien +nrqvtfskRr+gi KKA E+ vLCda+v ++ifss gkly+y++
  Zmw_sc02280.1.g00020.1.sm.mk  9 KRIENATNRQVTFSKRRAGIVKKAREIGVLCDADVGIVIFSSAGKLYDYCT 59
                                  79***********************************************96 PP
2K-box52.91.5e-1871145169
                         K-box   1 yqkssgksleeakaeslqqelakLkkeienLq......reqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                                   yq++sgk l+++k++sl+ e++++kke++n+q       +  hl+GedL+sL+ +eL  +e++L+++ ++ R+k+
  Zmw_sc02280.1.g00020.1.sm.mk  71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQielrlvLTAQHLKGEDLNSLQPRELIAIEEALQNGQTNLREKQ 145
                                   89999999************************5555554456*******************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.721161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-32296IPR002100Transcription factor, MADS-box
CDDcd002651.59E-40280No hitNo description
PRINTSPR004041.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.8E-882146IPR002487Transcription factor, K-box
PROSITE profilePS512979.37684151IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT FSKRRAGIVK KAREIGVLCD ADVGIVIFSS AGKLYDYCTP  60
RTTLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRLVLT AQHLKGEDLN  120
SLQPRELIAI EEALQNGQTN LREKQAIIHW L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19186178Myocyte-specific enhancer factor 2B
1tqe_Q2e-19186178Myocyte-specific enhancer factor 2B
1tqe_R2e-19186178Myocyte-specific enhancer factor 2B
1tqe_S2e-19186178Myocyte-specific enhancer factor 2B
6c9l_A2e-19186178Myocyte-specific enhancer factor 2B
6c9l_B2e-19186178Myocyte-specific enhancer factor 2B
6c9l_C2e-19186178Myocyte-specific enhancer factor 2B
6c9l_D2e-19186178Myocyte-specific enhancer factor 2B
6c9l_E2e-19186178Myocyte-specific enhancer factor 2B
6c9l_F2e-19186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962034.17e-92MADS-box transcription factor 4
SwissprotQ407037e-87MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLA0A1E5VSA35e-93A0A1E5VSA3_9POAL; MADS-box transcription factor 4
STRINGSi023214m3e-91(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Publications ? help Back to Top
  1. Ronai Z, et al.
    Transcription factor binding study by capillary zone electrophoretic mobility shift assay.
    Electrophoresis, 2003. 24(1-2): p. 96-100
    [PMID:12652578]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Kang HG,An G
    Morphological alterations by ectopic expression of the rice OsMADS4 gene in tobacco plants.
    Plant Cell Rep., 2005. 24(2): p. 120-6
    [PMID:15703945]
  4. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  5. Chen C, et al.
    Adapting rice anther culture to gene transformation and RNA interference.
    Sci. China, C, Life Sci., 2006. 49(5): p. 414-28
    [PMID:17172048]
  6. Yoshida H, et al.
    superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice.
    Plant Biotechnol. J., 2007. 5(6): p. 835-46
    [PMID:17764519]
  7. Yao SG,Ohmori S,Kimizu M,Yoshida H
    Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development.
    Plant Cell Physiol., 2008. 49(5): p. 853-7
    [PMID:18378529]
  8. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  9. Wang H, et al.
    OsMADS32 interacts with PI-like proteins and regulates rice flower development.
    J Integr Plant Biol, 2015. 57(5): p. 504-13
    [PMID:25081486]