PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc01684.1.g00060.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 105aa MW: 11227.4 Da PI: 5.1038 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 43.7 | 7e-14 | 67 | 104 | 1 | 38 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkm 38 rW++qe+laL+++r+em+ ++r+++lk+plWeevs+++ Zmw_sc01684.1.g00060.1.sm.mk 67 RWPRQETLALLKIRSEMDAAFREAALKGPLWEEVSRYV 104 8**********************************997 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MQQQQQQPGM PPFSPTAGAG TTTAQPSPIS SRPPEGHPEP GAGGSAPRAE DSFDHEGDRS 60 GSSVGSRWPR QETLALLKIR SEMDAAFREA ALKGPLWEEV SRYVV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004986012.1 | 1e-26 | trihelix transcription factor GTL1 isoform X1 | ||||
Refseq | XP_004986013.1 | 1e-26 | trihelix transcription factor GTL1 isoform X2 | ||||
Refseq | XP_015689742.1 | 7e-29 | PREDICTED: trihelix transcription factor GT-2-like | ||||
Swissprot | Q9C882 | 1e-14 | GTL1_ARATH; Trihelix transcription factor GTL1 | ||||
TrEMBL | J3LJ74 | 2e-26 | J3LJ74_ORYBR; Uncharacterized protein | ||||
STRING | OB03G11000.1 | 4e-27 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP15223 | 12 | 18 |
Publications ? help Back to Top | |||
---|---|---|---|
|