PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01269.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 168aa    MW: 19241.3 Da    PI: 10.1896
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01269.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.3e-29959151
                                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    krien + rqv+fskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
  Zmw_sc01269.1.g00050.1.sm.mkhc  9 KRIENPTSRQVSFSKRRNGLLKKAFELSVLCDAEVALVVFSTRGKLYEFAS 59
                                    79***********************************************86 PP

2K-box60.47.3e-21591243499
                           K-box  34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                                     + R+llGe Le++s++eL++Le +Leksl+ +R +K++ll eq+++l++ke  l+++n++Lr+k +
  Zmw_sc01269.1.g00050.1.sm.mkhc  59 SARKLLGERLEECSIEELHSLEVKLEKSLRIVRGRKTQLLEEQVRKLKEKEMTLRKNNEDLREKCK 124
                                     57*************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.104161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.12E-27361IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-30323IPR002100Transcription factor, MADS-box
CDDcd002653.40E-34359No hitNo description
PfamPF003197.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.95139129IPR002487Transcription factor, K-box
PfamPF014868.2E-2059124IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MVRGKTQLKR IENPTSRQVS FSKRRNGLLK KAFELSVLCD AEVALVVFST RGKLYEFASA  60
RKLLGERLEE CSIEELHSLE VKLEKSLRIV RGRKTQLLEE QVRKLKEKEM TLRKNNEDLR  120
EKCKDQPLLV APAAVDYMDV ETELYIGLPG RDNRPNKAAI AVSQSNRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-17160160MEF2C
5f28_B3e-17160160MEF2C
5f28_C3e-17160160MEF2C
5f28_D3e-17160160MEF2C
6byy_A3e-17160160MEF2 CHIMERA
6byy_B3e-17160160MEF2 CHIMERA
6byy_C3e-17160160MEF2 CHIMERA
6byy_D3e-17160160MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985919.18e-81MADS-box transcription factor 50 isoform X2
RefseqXP_004985920.18e-81MADS-box transcription factor 50 isoform X2
RefseqXP_012698462.18e-81MADS-box transcription factor 50 isoform X2
SwissprotQ9XJ603e-76MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLA0A2T7CIE03e-79A0A2T7CIE0_9POAL; Uncharacterized protein
STRINGGRMZM2G171365_P016e-78(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Publications ? help Back to Top
  1. Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR
    Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL.
    Genetics, 2006. 172(4): p. 2501-14
    [PMID:16452146]
  2. Park SJ, et al.
    Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod.
    Plant J., 2008. 56(6): p. 1018-29
    [PMID:18774969]
  3. Lee S,Jeong DH,An G
    A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses.
    Plant Signal Behav, 2008. 3(7): p. 471-4
    [PMID:19704489]
  4. Maas LF,McClung A,McCouch S
    Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice.
    Theor. Appl. Genet., 2010. 120(5): p. 895-908
    [PMID:19949767]
  5. Sun C, et al.
    The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice.
    Plant Cell, 2012. 24(8): p. 3235-47
    [PMID:22892321]
  6. Choi SC, et al.
    Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3.
    Plant Physiol., 2014. 164(3): p. 1326-37
    [PMID:24420930]
  7. Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM
    Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor.
    PeerJ, 2015. 3: p. e817
    [PMID:25780769]
  8. Jin J, et al.
    MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice.
    Plant Physiol., 2015. 168(4): p. 1275-85
    [PMID:25855537]
  9. Liu X, et al.
    Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.).
    Plant Cell Rep., 2016. 35(2): p. 357-68
    [PMID:26518431]
  10. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  11. Shibaya T, et al.
    Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice.
    Plant Cell Physiol., 2016. 57(9): p. 1828-38
    [PMID:27318280]
  12. Alter P, et al.
    Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1.
    Plant Physiol., 2016. 172(1): p. 389-404
    [PMID:27457125]