PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc01269.1.g00050.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 168aa MW: 19241.3 Da PI: 10.1896 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.3 | 2.3e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqv+fskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s Zmw_sc01269.1.g00050.1.sm.mkhc 9 KRIENPTSRQVSFSKRRNGLLKKAFELSVLCDAEVALVVFSTRGKLYEFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 60.4 | 7.3e-21 | 59 | 124 | 34 | 99 |
K-box 34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + R+llGe Le++s++eL++Le +Leksl+ +R +K++ll eq+++l++ke l+++n++Lr+k + Zmw_sc01269.1.g00050.1.sm.mkhc 59 SARKLLGERLEECSIEELHSLEVKLEKSLRIVRGRKTQLLEEQVRKLKEKEMTLRKNNEDLREKCK 124 57*************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.104 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.5E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.12E-27 | 3 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.40E-34 | 3 | 59 | No hit | No description |
Pfam | PF00319 | 7.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.951 | 39 | 129 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 8.2E-20 | 59 | 124 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MVRGKTQLKR IENPTSRQVS FSKRRNGLLK KAFELSVLCD AEVALVVFST RGKLYEFASA 60 RKLLGERLEE CSIEELHSLE VKLEKSLRIV RGRKTQLLEE QVRKLKEKEM TLRKNNEDLR 120 EKCKDQPLLV APAAVDYMDV ETELYIGLPG RDNRPNKAAI AVSQSNRA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-17 | 1 | 60 | 1 | 60 | MEF2C |
5f28_B | 3e-17 | 1 | 60 | 1 | 60 | MEF2C |
5f28_C | 3e-17 | 1 | 60 | 1 | 60 | MEF2C |
5f28_D | 3e-17 | 1 | 60 | 1 | 60 | MEF2C |
6byy_A | 3e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_B | 3e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_C | 3e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_D | 3e-17 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004985919.1 | 8e-81 | MADS-box transcription factor 50 isoform X2 | ||||
Refseq | XP_004985920.1 | 8e-81 | MADS-box transcription factor 50 isoform X2 | ||||
Refseq | XP_012698462.1 | 8e-81 | MADS-box transcription factor 50 isoform X2 | ||||
Swissprot | Q9XJ60 | 3e-76 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
TrEMBL | A0A2T7CIE0 | 3e-79 | A0A2T7CIE0_9POAL; Uncharacterized protein | ||||
STRING | GRMZM2G171365_P01 | 6e-78 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1413 | 33 | 79 |