PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00978.1.g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 277aa    MW: 30733.3 Da    PI: 7.26
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00978.1.g00110.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.51.3e-072773347
                                  SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                                  +WT +Ed+ +  a +  + +   +W +Ia++++ gRt+ +  +r+q +
  Zmw_sc00978.1.g00110.1.am.mk 27 PWTWDEDKMFETALAIVPEEapnRWMLIASMVP-GRTAQEASDRYQLL 73
                                  8*****************99*************.*****999999976 PP

2Myb_DNA-binding48.22.6e-15121165347
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +WT+eE+ l++d+  ++G  +Wk I+r+  k+Rt+ q+ s+ qky
  Zmw_sc00978.1.g00110.1.am.mk 121 PWTEEEHRLFLDGLDKFGRSDWKNISRHSVKTRTPSQVASHAQKY 165
                                   8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.4E-62476IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-62573IPR009057Homeodomain-like
SuperFamilySSF466892.8E-112678IPR009057Homeodomain-like
PROSITE profilePS500907.1782774IPR017877Myb-like domain
PfamPF002493.0E-62773IPR001005SANT/Myb domain
CDDcd001674.87E-72774No hitNo description
PROSITE profilePS5129418.323114170IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-10116174IPR009057Homeodomain-like
SuperFamilySSF466891.44E-17116169IPR009057Homeodomain-like
SMARTSM007176.9E-11118168IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.1E-17119169IPR006447Myb domain, plants
CDDcd001673.48E-11121166No hitNo description
PfamPF002492.0E-11121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MADYYGAGGQ SSSSLPWTEP STSGSRPWTW DEDKMFETAL AIVPEEAPNR WMLIASMVPG  60
RTAQEASDRY QLLLFDVDLI ESGLVELPQA WDKDDRAKQV HVPANLDHDT GARRGRRRSV  120
PWTEEEHRLF LDGLDKFGRS DWKNISRHSV KTRTPSQVAS HAQKYFLRKA NRANAKRKSI  180
NDVTTSPPRE TVQGNEEDAA QAPSLPPHDQ ISITPRTRFF GDAPAGEYDA GGYLADTALP  240
VQRAVGLLSS AQPGAPAARI DHQVSIVSFK LRFLAKA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808699.15e-62transcription factor DIVARICATA-like
TrEMBLA0A3L6T4N12e-61A0A3L6T4N1_PANMI; Transcription factor DIVARICATA-like
STRINGSi023363m3e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687