PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00755.1.g00320.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 339aa    MW: 36116.1 Da    PI: 4.2993
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+WT++Ed +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl 16 RGSWTPQEDMRLIAYIQKHGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                                  89******************************99************97 PP

               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T++E+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l  69 RGNFTADEEETIIKLHGLLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                                   89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.361163IPR017930Myb domain
SMARTSM007171.1E-121565IPR001005SANT/Myb domain
PfamPF002493.4E-151663IPR001005SANT/Myb domain
CDDcd001672.00E-101863No hitNo description
PROSITE profilePS5129424.72164118IPR017930Myb domain
SMARTSM007173.9E-1468116IPR001005SANT/Myb domain
PfamPF002491.6E-1469114IPR001005SANT/Myb domain
CDDcd001677.90E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-27141182105C-Myb DNA-Binding Domain
1msf_C2e-27141182105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953532.11e-142myb-related protein Zm1
SwissprotP200241e-143MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0A9HFK41e-146A0A0A9HFK4_ARUDO; Uncharacterized protein
STRINGPavir.Aa01159.1.p1e-143(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30