PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00153.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 410aa    MW: 45408.5 Da    PI: 6.0776
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00153.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.5e-16119166148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Zmw_sc00153.1.g00090.1.am.mk 119 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 166
                                   788*******************************************97 PP

2Myb_DNA-binding47.44.6e-15172215146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg+++++E++l++  +k lG++ W+ Ia+ ++ gRt++++k++w++
  Zmw_sc00153.1.g00090.1.am.mk 172 RGSFSQQEEDLIISFHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 215
                                   899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.594114170IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-23114169IPR009057Homeodomain-like
SuperFamilySSF466892.1E-28116213IPR009057Homeodomain-like
SMARTSM007176.8E-13118168IPR001005SANT/Myb domain
PfamPF002493.6E-14119166IPR001005SANT/Myb domain
CDDcd001672.33E-11122166No hitNo description
Gene3DG3DSA:1.10.10.605.2E-25170222IPR009057Homeodomain-like
SMARTSM007171.4E-14171219IPR001005SANT/Myb domain
PROSITE profilePS5129419.651171221IPR017930Myb domain
PfamPF002491.2E-13172215IPR001005SANT/Myb domain
CDDcd001671.78E-10174214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MVGEDWDVSG HYCTQQCREG ETGHHGGDGW NCKCMDRAIS LNEPECIVRA TVPAARRIGR  60
ASLFNTIDGA GKETTTRLKR TTVVGQHQRS QLACVARLPC LPEESMGREA EAGRPKLRRG  120
LWSPEEDEKL YNHIIRYGVG CWSSVPKLAG LERCGKSCRL RWINYLRPDL KRGSFSQQEE  180
DLIISFHKIL GNRWSQIASQ LPGRTDNEIK NFWNSCIKKK LQQQGIDPST HKPINEDAAE  240
PSDDCNQLPT DEHCLPIAAA ASDPLAPHSP AVSFDPLSVT NAPAMQPPYG AAHSFRSDNL  300
CDYNLSDAAT YSAYNGGGDS SSNSNSAWTC GNVIGGEPMP HMDIFGRDVE PYSFDPAKFS  360
PWNHQQQQHH HHDADAAAGF PIRSMSRDLP ESCFDLARGA LEDEFSVDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-301132211108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968898.11e-171myb-related protein Hv33
RefseqXP_004968899.11e-171myb-related protein Hv33
TrEMBLK3XJZ71e-170K3XJZ7_SETIT; Uncharacterized protein
STRINGSi002220m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041