PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma79g00240.1 | ||||||||
Common Name | ZOSMA_79G00240 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 98aa MW: 11265 Da PI: 10.0246 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.1 | 1.2e-14 | 17 | 58 | 7 | 48 |
HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 eEd ll ++++++G g+W+ ++++ g++R++k+c++rw++yl Zosma79g00240.1 17 EEDVLLTRYIEKHGEGNWSHVPARAGLRRCRKSCRLRWLNYL 58 9****************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.164 | 6 | 62 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-19 | 6 | 61 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.7E-8 | 10 | 60 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.01E-20 | 15 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.96E-9 | 17 | 58 | No hit | No description |
Pfam | PF00249 | 1.4E-13 | 17 | 58 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS50090 | 3.996 | 59 | 97 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 2.7E-8 | 62 | 93 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MSQIEDISVR KGARSCEEDV LLTRYIEKHG EGNWSHVPAR AGLRRCRKSC RLRWLNYLQP 60 NIKRGHFSAD EVDMIIRLHN LLGNKYLIIT THVVSGH* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Activates DODA1 and CYP76AD1 in the betalain red pigment pathway. | |||||
UniProt | Activates DODA1 and CYP76AD1 in the betalain red pigment pathway. {ECO:0000305|PubMed:25436858}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: This dominant Y allele is highly expressed, resulting in an inner red flesh of the beet. {ECO:0000305|PubMed:25436858}. | |||||
UniProt | INDUCTION: This recessive y allele is expressed at low levels, resulting in an inner white flesh of the beet. However, yy plants still can make pigments but never make as much of it or have it in the same location as YY or Yy plants with an inner red flesh. {ECO:0000305|PubMed:25436858}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016744843.1 | 4e-40 | PREDICTED: transcription factor MYB114-like isoform X2 | ||||
Swissprot | M1ETA5 | 4e-32 | MYB1R_BETVU; Transcription factor MYB1 | ||||
Swissprot | M1ETK3 | 4e-32 | MYB1W_BETVU; Transcription factor MYB1 | ||||
TrEMBL | A0A0K9NNK3 | 7e-66 | A0A0K9NNK3_ZOSMR; Myb domain protein 68 | ||||
STRING | Gorai.001G087200.1 | 4e-38 | (Gossypium raimondii) | ||||
STRING | Gorai.001G087400.1 | 4e-38 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66370.1 | 6e-34 | myb domain protein 113 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma79g00240.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|