PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma74g00200.1 | ||||||||
Common Name | ZOSMA_74G00200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 178aa MW: 20379 Da PI: 10.5985 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.7 | 3.2e-14 | 14 | 60 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l+d+v ++G+++W+ I+ ++ +R++k+c++rw++ Zosma74g00200.1 14 RGHWKPGEDIKLKDLVSKYGPHNWNIISDKFDGRRSGKSCRLRWFNQ 60 899*****************************9***********996 PP | |||||||
2 | Myb_DNA-binding | 49.7 | 8.6e-16 | 67 | 109 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r+++ +eEd++l+ a++ +G++ W++Iar ++ gRt++ +k+ w+ Zosma74g00200.1 67 RKAFGEEEDDRLLSAHRVYGNK-WSLIARLFP-GRTDNAVKNQWH 109 78899*****************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.558 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.11E-28 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.3E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-13 | 14 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.4E-22 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.17E-10 | 17 | 59 | No hit | No description |
PROSITE profile | PS51294 | 16.957 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 9.4E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-13 | 67 | 109 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-20 | 69 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.05E-10 | 72 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MKFLTPTTTA ELTRGHWKPG EDIKLKDLVS KYGPHNWNII SDKFDGRRSG KSCRLRWFNQ 60 LDPKINRKAF GEEEDDRLLS AHRVYGNKWS LIARLFPGRT DNAVKNQWHV ITARKQRQQL 120 IKTYGRRRKR FSSSLPSDHQ PSTCSGESTI TSNDGDAINE KIINSVPFYD FLGVGNT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-29 | 11 | 115 | 4 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020598432.1 | 6e-64 | transcription factor MYB56-like | ||||
Refseq | XP_020599341.1 | 6e-64 | transcription factor MYB56-like | ||||
Swissprot | Q5NBM8 | 2e-58 | CSA_ORYSJ; Transcription factor CSA | ||||
TrEMBL | A0A0K9NPI7 | 1e-129 | A0A0K9NPI7_ZOSMR; Myb domain protein 52 | ||||
STRING | GSMUA_Achr5P27750_001 | 2e-63 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP294 | 38 | 260 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69560.1 | 5e-60 | myb domain protein 105 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma74g00200.1 |