PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zosma57g00620.1

Common Name

ZOSMA_57G00620

Organism

Zostera marina

Taxonomic ID

29655

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera

Family

NF-YB

Protein Properties

Length: 110aa MW: 12152.9 Da PI: 8.7371

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zosma57g00620.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	145.6	1.1e-45	24	108	3	87
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 +drflPianvsrimk++lP nakisk+aket+qecvsef+sf+t+eas+kc+ ekrktingddllw++ l f+ y plkvyl Zosma57g00620.1 24 SNDRFLPIANVSRIMKRALPINAKISKEAKETIQECVSEFVSFITGEASEKCHSEKRKTINGDDLLWSMNRLDFDPYTIPLKVYL 108 68**********************************************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.7E-43	18	108	IPR009072	Histone-fold
SuperFamily	SSF47113	3.44E-33	25	108	IPR009072	Histone-fold
Pfam	PF00808	2.2E-26	28	92	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.6E-14	56	74	No hit	No description
PRINTS	PR00615	2.6E-14	75	93	No hit	No description
PRINTS	PR00615	2.6E-14	94	109	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 110 aa Download sequence Send to blast
MGLATNNPMV GSSSNSNSKR DAASNDRFLP IANVSRIMKR ALPINAKISK EAKETIQECV 60 SEFVSFITGE ASEKCHSEKR KTINGDDLLW SMNRLDFDPY TIPLKVYLV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1n1j_A	2e-38	25	108	5	88	NF-YB
4g91_B	2e-38	25	108	4	87	Transcription factor HapC (Eurofung)
4g92_B	2e-38	25	108	4	87	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008464158.1	3e-48	PREDICTED: nuclear transcription factor Y subunit B-3
Refseq	XP_008464159.1	3e-48	PREDICTED: nuclear transcription factor Y subunit B-3
Refseq	XP_022140566.1	1e-48	nuclear transcription factor Y subunit B-3-like, partial
Refseq	XP_023513391.1	3e-48	nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	9e-47	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	Q69J40	3e-46	NFYBA_ORYSJ; Nuclear transcription factor Y subunit B-10
TrEMBL	A0A0K9NVE4	4e-75	A0A0K9NVE4_ZOSMR; Nuclear transcription factor Y subunit B-3
STRING	XP_008464158.1	1e-47	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP201	38	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	4e-49	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	Zosma57g00620.1

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]