PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zosma57g00570.1

Common Name

ZOSMA_57G00570

Organism

Zostera marina

Taxonomic ID

29655

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera

Family

NF-YB

Protein Properties

Length: 85aa MW: 9897.38 Da PI: 6.5954

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zosma57g00570.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	102.9	2.3e-32	1	73	17	89
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 m+++lP naki+k+aketvqecvsefisf+t+ea d+cqrekr+ ingddllw++ l fe y +lkv l + Zosma57g00570.1 1 MRRALPFNAKITKEAKETVQECVSEFISFITGEAIDNCQREKRNLINGDDLLWSMNRLYFESYTISLKVNLVR 73 89******************************************************************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00808	3.8E-16	1	55	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamily	SSF47113	2.01E-21	1	72	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	3.2E-28	1	72	IPR009072	Histone-fold
PRINTS	PR00615	9.0E-12	19	37	No hit	No description
PRINTS	PR00615	9.0E-12	38	56	No hit	No description
PRINTS	PR00615	9.0E-12	57	75	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MRRALPFNAK ITKEAKETVQ ECVSEFISFI TGEAIDNCQR EKRNLINGDD LLWSMNRLYF 60 ESYTISLKVN LVRSELILKY TFEN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	9e-26	1	73	17	89	Transcription factor HapC (Eurofung)
4g92_B	9e-26	1	73	17	89	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003571418.1	2e-32	nuclear transcription factor Y subunit B-3
Swissprot	O23310	7e-33	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A0K9NVE2	8e-55	A0A0K9NVE2_ZOSMR; Transcriptional activator hap3
STRING	BRADI3G15670.1	7e-32	(Brachypodium distachyon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP201	38	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	3e-35	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	Zosma57g00570.1

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]