PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma48g00010.1
Common NameZOSMA_48G00010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MYB
Protein Properties Length: 411aa    MW: 46446.3 Da    PI: 9.9365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma48g00010.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.5e-14454148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg...kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll+ +v q+G++ W++ +++mg    +R +k+c +rw +yl
  Zosma48g00010.1  4 RQRWQPEEDALLLAYVSQHGPKEWSLLPQRMGlssFHRDPKSCLERWKNYL 54
                     89*********************************99************97 PP

2Myb_DNA-binding33.31.1e-1060104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ ++eE+ l + +  ++G++ W++Ia++++ gRt+k +  +w  +
  Zosma48g00010.1  60 KGSLSPEEQSLVISLQSKHGNK-WNLIASHLP-GRTPKRLGKWWEVF 104
                      57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.714158IPR017930Myb domain
SMARTSM007172.7E-12356IPR001005SANT/Myb domain
SuperFamilySSF466892.22E-224100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-19661IPR009057Homeodomain-like
CDDcd001674.10E-9654No hitNo description
PfamPF139211.9E-12770No hitNo description
SMARTSM007177.6E-1059107IPR001005SANT/Myb domain
PROSITE profilePS5129416.59959109IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-1662107IPR009057Homeodomain-like
CDDcd001672.29E-764105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MKDRQRWQPE EDALLLAYVS QHGPKEWSLL PQRMGLSSFH RDPKSCLERW KNYLRPGLKK  60
GSLSPEEQSL VISLQSKHGN KWNLIASHLP GRTPKRLGKW WEVFKEKQIK NNQKKKNQQH  120
QQQQQCCYSM GETGSNSNTG TTSVILRPQQ GEYDHILETF ADKYVVNKGK MLPDLSPSMS  180
SCNDSAPPHQ NLGGGTTLGV AAYSSYQNLL PRFAHQNIPP WMSTTTTIAV AGVSATGGCN  240
NSNSPSVTLS LSPGENGGGG GSGGKNHVGL LQVSTLTQLC RELDEARQSL MHHKKEANWR  300
LSRLEQQLES EKARKKREKE EEIKTKIIAL RKEEESCLDR LNTEYRDQLS AIQRDADDKE  360
AKMMEMWSSK HSKLTRLIGH FGSSDASLDH HHRRRHHHLP RSSPFQHQQQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-13793789MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-13793789C-Myb DNA-Binding Domain
1msf_C5e-13793789C-Myb DNA-Binding Domain
3zqc_A5e-13111169110MYB3
3zqc_D5e-13111169110MYB3
3zqc_G5e-13111169110MYB3
3zqc_J5e-13111169110MYB3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1313318RKKREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027075224.11e-114protein rough sheath 2 homolog
RefseqXP_027178645.11e-114protein rough sheath 2 homolog
TrEMBLA0A0K9P1H90.0A0A0K9P1H9_ZOSMR; Myb domain protein 94
STRINGXP_006430817.11e-113(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.12e-70MYB family protein