PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma230g00330.1 | ||||||||
Common Name | ZOSMA_230G00330 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 77aa MW: 8353.05 Da PI: 10.3974 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 107.7 | 5.8e-34 | 11 | 76 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 e++GlnPG +vllvv g +l+f+ n ly+yaqk+lPP+kkkPvskkklk+eklkqG+++PGe Zosma230g00330.1 11 DKESQGLNPGTVVLLVVMGAMLLFIGVNIGLYMYAQKTLPPKKKKPVSKKKLKKEKLKQGISAPGE 76 579**************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 1.2E-32 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 77 aa Download sequence Send to blast |
MADEFEGNMF DKESQGLNPG TVVLLVVMGA MLLFIGVNIG LYMYAQKTLP PKKKKPVSKK 60 KLKKEKLKQG ISAPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010104121.2 | 9e-22 | DNA-binding protein S1FA | ||||
Refseq | XP_024026346.1 | 9e-22 | DNA-binding protein S1FA | ||||
Swissprot | P42553 | 1e-13 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
TrEMBL | A0A0K9PKG0 | 6e-46 | A0A0K9PKG0_ZOSMR; DNA-binding protein S1FA1 | ||||
STRING | XP_010104121.1 | 9e-22 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5154 | 35 | 63 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma230g00330.1 |