PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma21g00380.1 | ||||||||
Common Name | ZOSMA_21G00380 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 152aa MW: 17310.9 Da PI: 10.32 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 65.7 | 8.5e-21 | 5 | 51 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+W++eEd++lvd+v q+G ++W+t++ +g++R++k+c++rw++y Zosma21g00380.1 5 RGAWSAEEDKKLVDYVMQYGEKRWRTVPDLVGLNRCGKSCRLRWLNY 51 89********************************************9 PP | |||||||
2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 58 | 103 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ ++eE+ l+++++++ G++ W++Ia +++ gRt++++k++w++yl Zosma21g00380.1 58 RGNISKEEEHLIIRLHNLIGNR-WALIAGRLP-GRTDNEIKNYWNTYL 103 7899******************.*********.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 27.229 | 1 | 56 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.93E-30 | 3 | 99 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.4E-16 | 4 | 54 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-18 | 5 | 51 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-23 | 6 | 59 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.88E-12 | 7 | 52 | No hit | No description |
SMART | SM00717 | 2.5E-14 | 57 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.287 | 57 | 107 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.2E-15 | 58 | 103 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.5E-24 | 60 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.44E-10 | 62 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MVKKRGAWSA EEDKKLVDYV MQYGEKRWRT VPDLVGLNRC GKSCRLRWLN YVKPGIKRGN 60 ISKEEEHLII RLHNLIGNRW ALIAGRLPGR TDNEIKNYWN TYLKYKSVSN NDLNSVICGG 120 SAVVSAPPLK VFETRDLFTS DIPQPSASRF S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-28 | 5 | 106 | 7 | 107 | B-MYB |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009388433.1 | 5e-58 | PREDICTED: transcription factor MYB23-like | ||||
Swissprot | Q9S9K9 | 1e-49 | MYB3_ARATH; Transcription factor MYB3 | ||||
TrEMBL | A0A0K9PJQ6 | 1e-107 | A0A0K9PJQ6_ZOSMR; Myb domain protein 4 | ||||
STRING | GSMUA_Achr2P17960_001 | 2e-57 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 4e-52 | myb domain protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma21g00380.1 |