PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma19g01070.1 | ||||||||
Common Name | ZOSMA_19G01070 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 145aa MW: 16209.7 Da PI: 8.4996 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 64.4 | 4.5e-20 | 12 | 62 | 4 | 53 |
YABBY 4 fssseqvCyvqCnfCntilavsvPsts.lfkvvtvrCGhCtsllsvnlaka 53 ++ +q+CyvqC+fCntil+vsvP + +++vvtvrCGhC llsv+ ++ Zosma19g01070.1 12 QDHKNQLCYVQCSFCNTILLVSVPCKNlMVSVVTVRCGHCQGLLSVDFETE 62 56789*******************8651679***************98875 PP | |||||||
2 | YABBY | 88.2 | 2.2e-27 | 79 | 140 | 99 | 160 |
YABBY 99 eklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknW 160 ++l e+ed ++ + v++PPekr+r+Psayn+fikeei+rika+ P+++h+eafs+aakn Zosma19g01070.1 79 FTLIEKEDIPTSAAVVVNKPPEKRRRAPSAYNCFIKEEIKRIKAEHPSVTHKEAFSTAAKNV 140 44444455555556679********************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.4E-18 | 15 | 68 | IPR006780 | YABBY protein |
Pfam | PF04690 | 8.2E-25 | 88 | 141 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 2.62E-7 | 95 | 137 | IPR009071 | High mobility group box domain |
CDD | cd00084 | 5.69E-5 | 103 | 131 | No hit | No description |
Gene3D | G3DSA:1.10.30.10 | 1.0E-4 | 103 | 132 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MSNSMATTTP FQDHKNQLCY VQCSFCNTIL LVSVPCKNLM VSVVTVRCGH CQGLLSVDFE 60 TEPSFVPLHF LASLHRDNFT LIEKEDIPTS AAVVVNKPPE KRRRAPSAYN CFIKEEIKRI 120 KAEHPSVTHK EAFSTAAKNV HKYT* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Essential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:9093862, ECO:0000269|PubMed:9118807}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:12183381}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001344732.1 | 3e-47 | protein YABBY 8 | ||||
Swissprot | Q9LDT3 | 3e-36 | YAB4_ARATH; Axial regulator YABBY 4 | ||||
TrEMBL | A0A0K9PNH1 | 1e-102 | A0A0K9PNH1_ZOSMR; Crabs claw | ||||
STRING | XP_008389678.1 | 3e-46 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP13625 | 28 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23420.1 | 1e-38 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma19g01070.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|