PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma180g00130.1
Common NameZOSMA_180G00130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 270aa    MW: 31149.4 Da    PI: 8.9718
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma180g00130.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1522.7e-4741283128
               NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       pGfrFhPtdeel+v+yL++  +gk+   +++i ++diy++ePwdLp ++k +e+ewyfF++rd+k   g r+nr+t++g+Wkatg+d++v+  
  Zosma180g00130.1   4 PGFRFHPTDEELLVFYLRQAGHGKD--SFNIIGSLDIYRHEPWDLPGMAKIGEREWYFFVPRDRKRVYGGRPNRTTERGFWKATGSDRSVYGV 94 
                       9*****************9999888..4478***************888999***************************************98 PP

               NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++ ++glkktLvfy+grap+g ktdWvm+eyrl
  Zosma180g00130.1  95 gRKDVIGLKKTLVFYRGRAPRGLKTDWVMNEYRL 128
                       67778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.5252148IPR003441NAC domain
SuperFamilySSF1019418.37E-533148IPR003441NAC domain
PfamPF023651.1E-244128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MELPGFRFHP TDEELLVFYL RQAGHGKDSF NIIGSLDIYR HEPWDLPGMA KIGEREWYFF  60
VPRDRKRVYG GRPNRTTERG FWKATGSDRS VYGVGRKDVI GLKKTLVFYR GRAPRGLKTD  120
WVMNEYRLPT ATTSVPHDDM VLCKVYRKAT SIRVLEQRAR NTGEFSAPQT PELEMDSKYL  180
GLEDVKKVEE LSAYSSSAKK RFPELKLEVP AAMTSFQRII QDPIFTQLRS PWSPYSNLLS  240
FCDQNLSFVY DDTFCPTDQD HQVWLGPAQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-48415122171NAC domain-containing protein 19
3swm_B2e-48415122171NAC domain-containing protein 19
3swm_C2e-48415122171NAC domain-containing protein 19
3swm_D2e-48415122171NAC domain-containing protein 19
3swp_A2e-48415122171NAC domain-containing protein 19
3swp_B2e-48415122171NAC domain-containing protein 19
3swp_C2e-48415122171NAC domain-containing protein 19
3swp_D2e-48415122171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020093751.12e-88NAC domain-containing protein 35
SwissprotQ10S657e-80NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A0K9PT410.0A0A0K9PT41_ZOSMR; NAC domain protein
STRINGGSMUA_Achr11P01320_0011e-83(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-76NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]