PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma11g00640.1 | ||||||||
Common Name | ZOSMA_11G00640 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 177aa MW: 18637.5 Da PI: 5.729 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 161.8 | 9.8e-51 | 21 | 115 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 e d++lPianv+rimkk+lP+nakisk+aket+qec+sefisfv+seasdkc++e+rkt+ngdd++wa++tlGf+ +v+p+k yl+kyr+ e+e Zosma11g00640.1 21 EGDQLLPIANVGRIMKKILPSNAKISKEAKETMQECASEFISFVASEASDKCNKERRKTVNGDDICWAFGTLGFDSFVQPMKRYLNKYRDYESE 114 679****************************************************************************************998 PP NF-YB 97 k 97 + Zosma11g00640.1 115 R 115 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-47 | 19 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.55E-36 | 23 | 119 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.6E-27 | 25 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.5E-17 | 53 | 71 | No hit | No description |
PRINTS | PR00615 | 2.5E-17 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 2.5E-17 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MTDGGSSSAA AKTGGSGGGG EGDQLLPIAN VGRIMKKILP SNAKISKEAK ETMQECASEF 60 ISFVASEASD KCNKERRKTV NGDDICWAFG TLGFDSFVQP MKRYLNKYRD YESERAVVAA 120 ATAASEATLF RHAGSDGGDD HNQDASSSDR HFKMDLAGSS SDSTTTTTLS FNVLGK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-39 | 21 | 110 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-39 | 21 | 110 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009411690.1 | 3e-56 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | O23310 | 2e-48 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0K9Q154 | 1e-126 | A0A0K9Q154_ZOSMR; Nuclear transcription factor Y subunit B-5 | ||||
STRING | GSMUA_Achr8P10020_001 | 1e-55 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-47 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma11g00640.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|