PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma112g00580.1 | ||||||||
Common Name | ZOSMA_112G00580 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 237aa MW: 27896.5 Da PI: 6.6377 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.7 | 5.7e-18 | 27 | 74 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd ll+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl Zosma112g00580.1 27 RGPWTVEEDTLLIHYIAYHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 74 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.8 | 2.2e-17 | 80 | 123 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE+ l++d++ ++G++ W++Ia++++ gRt++++k++w++ Zosma112g00580.1 80 RGNLTPEEQMLILDLHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 123 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.441 | 22 | 74 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.11E-31 | 25 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.6E-15 | 26 | 76 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.9E-16 | 27 | 74 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-23 | 28 | 81 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.50E-10 | 29 | 74 | No hit | No description |
PROSITE profile | PS51294 | 24.213 | 75 | 129 | IPR017930 | Myb domain |
SMART | SM00717 | 1.2E-15 | 79 | 127 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-16 | 80 | 123 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-24 | 82 | 128 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.85E-11 | 84 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009686 | Biological Process | gibberellin biosynthetic process | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MSGKKGRREQ QEYEEVEVEV EEIELRRGPW TVEEDTLLIH YIAYHGEGRW NLLARCSGLK 60 RTGKSCRLRW LNYLKPDVKR GNLTPEEQML ILDLHSKWGN RWSKIAQHLP GRTDNEIKNY 120 WRTRVQKHAK QLKIDANSTL FQDAIRRFWM PSLIQKISEQ QQQQHQPQQQ RPQTEIANHN 180 MMMVEFDEKY NNTSQFVPEG EEGRVLGSAV GGDEVSDWAM MEESLWSLWM NDSIIS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-25 | 24 | 127 | 1 | 103 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 2e-25 | 24 | 127 | 24 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}. | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00216 | DAP | Transfer from AT1G68320 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}. | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017701316.1 | 4e-88 | transcription factor MYB62-like | ||||
Swissprot | Q10MB4 | 2e-77 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
Swissprot | Q2QZJ8 | 5e-78 | JAMYB_ORYSJ; Transcription factor JAMYB | ||||
TrEMBL | A0A0K9Q565 | 1e-175 | A0A0K9Q565_ZOSMR; Transcription factor MYB23 | ||||
STRING | XP_008807088.1 | 2e-87 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP198 | 38 | 330 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68320.1 | 1e-77 | myb domain protein 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma112g00580.1 |