PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma107g00550.1 | ||||||||
Common Name | ZOSMA_107G00550 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 164aa MW: 18903.6 Da PI: 10.9582 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.5 | 6.5e-18 | 27 | 72 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg WT+ Ed +l ++v+++G ++W+ Iar + gR++k+c++rw++ Zosma107g00550.1 27 RGHWTPTEDSRLRELVTRFGAKNWNFIARNLD-GRSGKSCRLRWFNQ 72 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 31.4 | 4.4e-10 | 79 | 122 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r+++T+ E+e+lv + +G++ W++ ar + gRt++ +k+ w+ Zosma107g00550.1 79 RMPFTAAEEERLVVGQLVYGSK-WALLARLFFPGRTDNAVKNQWH 122 789*******************.*******988***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.684 | 22 | 77 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.78E-26 | 26 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.2E-13 | 26 | 75 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-16 | 27 | 72 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-25 | 28 | 80 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.28E-12 | 30 | 71 | No hit | No description |
SMART | SM00717 | 1.8E-6 | 78 | 127 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 8.393 | 78 | 129 | IPR017930 | Myb domain |
Pfam | PF00249 | 6.1E-7 | 79 | 122 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.05E-5 | 81 | 122 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-13 | 81 | 124 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MSLVQTEEEA ERKRENQHRD VAKLFIRGHW TPTEDSRLRE LVTRFGAKNW NFIARNLDGR 60 SGKSCRLRWF NQLDPRINRM PFTAAEEERL VVGQLVYGSK WALLARLFFP GRTDNAVKNQ 120 WHVIEARKTR RSTTKPPPLY SSSTITVVPA DLPFFDFLGV GST* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-27 | 25 | 129 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as a cell-specific local repressor of quiescent center (QC) self-renewal by cell divisions in the primary root. Counteracts brassinosteroid (BR)-mediated cell division in the QC cells (PubMed:24981610). Regulates maternally seed size, especially before the heart stage, promoting both endothelial cells expansion and cell number in the outer integument layer of the seed coat (PubMed:23911125). Modulates the expression of genes involved in cell wall metabolism such as cell division and expansion (PubMed:23911125, PubMed:24981610). Negative regulator of flowering via the repression of FT transcription (PubMed:25343985). {ECO:0000269|PubMed:23911125, ECO:0000269|PubMed:24981610, ECO:0000269|PubMed:25343985}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Levels follow a circadian cycle with a progressive decrease during the day time (at protein level) (PubMed:25343985). Down-regulated by brassinosteroids (BRs) in a dose- and time-dependent manner. Repressed by BES1. Auto-activation of expression (PubMed:24981610). Targeted to 26S proteasomal degradation by the CULLIN3 (CUL3)-based E3 ligases CRL3(BPMs) (PubMed:25343985). {ECO:0000269|PubMed:24981610, ECO:0000269|PubMed:25343985}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022949264.1 | 4e-53 | transcription factor CSA-like | ||||
Swissprot | Q6R053 | 6e-50 | MYB56_ARATH; Transcription factor MYB56 | ||||
TrEMBL | A0A0K9Q445 | 1e-117 | A0A0K9Q445_ZOSMR; Uncharacterized protein | ||||
STRING | XP_004162825.1 | 8e-53 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP294 | 38 | 260 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G17800.1 | 3e-52 | myb domain protein 56 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma107g00550.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|