PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma104g00390.1 | ||||||||
Common Name | ZOSMA_104G00390 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 211aa MW: 24462.6 Da PI: 7.694 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41.4 | 3.3e-13 | 125 | 169 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E+ l++++ ++G g+W++I+r + +Rt+ q+ s+ qky Zosma104g00390.1 125 AWTEDEHRLFLQGLDMYGRGDWRSISRNLVITRTPTQVASHAQKY 169 6*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.89 | 2 | 62 | IPR017877 | Myb-like domain |
SMART | SM00717 | 21 | 6 | 64 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.73E-6 | 8 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.395 | 118 | 174 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.03E-16 | 120 | 175 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-10 | 122 | 172 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 5.2E-16 | 123 | 172 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 5.8E-12 | 125 | 169 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.13E-9 | 125 | 169 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-9 | 125 | 171 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MEGEGRNNLW TWEENKIFEM ALIPNCIETM NSSKQFEFWE EIAGQVHGKT VDDVKHHFEL 60 LLEDINNIDL GLVDLPDYRC SSKFCTNHLA QPEQGKAYSP VPSIIISATN MNTQHTELER 120 RRAIAWTEDE HRLFLQGLDM YGRGDWRSIS RNLVITRTPT QVASHAQKYY KRLKSSGKEK 180 RRSSIHDIKI KQQISTENDH TQQPKPAQRK * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015947035.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_015947036.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_016181553.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_020968725.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_020968726.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_020988223.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_025624932.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_025624933.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_025624934.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_025682557.1 | 2e-56 | transcription factor SRM1 | ||||
Refseq | XP_029152247.1 | 2e-56 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 8e-52 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A0K9Q4T4 | 1e-158 | A0A0K9Q4T4_ZOSMR; Myb family transcription factor | ||||
STRING | GLYMA20G01450.1 | 1e-55 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP842 | 30 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 3e-54 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma104g00390.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|