PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM5G891280_P01 | ||||||||
Common Name | MADS70, Zm.125827 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 247aa MW: 25302.4 Da PI: 7.5862 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 69 | 4.5e-22 | 18 | 65 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 rie++ rqv fskRr+g++KKA+ELS+LC+a+va ++fs+ gk + + GRMZM5G891280_P01 18 RIESDEARQVCFSKRRAGLFKKASELSILCGADVAAVVFSPAGKAFSF 65 8******************************************97766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.7E-35 | 9 | 68 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 26.717 | 9 | 69 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.62E-29 | 9 | 82 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.24E-40 | 10 | 81 | No hit | No description |
PRINTS | PR00404 | 3.6E-20 | 11 | 31 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-26 | 18 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-20 | 31 | 46 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-20 | 46 | 67 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009559 | Biological Process | embryo sac central cell differentiation | ||||
GO:0009960 | Biological Process | endosperm development | ||||
GO:0043078 | Cellular Component | polar nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MAPPRRPSMG RQKIEIRRIE SDEARQVCFS KRRAGLFKKA SELSILCGAD VAAVVFSPAG 60 KAFSFGHPSV ESVVDRFLAS STPSPAGAGA GAGHSSAGGG EDRAVSELNR QHGDLRAQLD 120 AEKARQERAD EAIRKEREAG SPAMAWIDAD LGAMGHDDLV AFWAALAGVQ AAVAASADQL 180 LRDALLVGRR GRQQQQPAAQ LGGGGVAFDV GAFGIGVQVP PPPGFAGVDL QGFGGQAAAI 240 LGAGGPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 3e-17 | 9 | 90 | 1 | 82 | MEF2 CHIMERA |
6byy_B | 3e-17 | 9 | 90 | 1 | 82 | MEF2 CHIMERA |
6byy_C | 3e-17 | 9 | 90 | 1 | 82 | MEF2 CHIMERA |
6byy_D | 3e-17 | 9 | 90 | 1 | 82 | MEF2 CHIMERA |
6bz1_A | 3e-17 | 9 | 90 | 1 | 82 | MEF2 CHIMERA |
6bz1_B | 3e-17 | 9 | 90 | 1 | 82 | MEF2 CHIMERA |
6bz1_C | 3e-17 | 9 | 90 | 1 | 82 | MEF2 CHIMERA |
6bz1_D | 3e-17 | 9 | 90 | 1 | 82 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.125827 | 0.0 | endosperm| meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM5G891280 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM5G891280_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU969208 | 0.0 | EU969208.1 Zea mays clone 326824 DNA binding protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001151024.1 | 1e-172 | uncharacterized protein LOC100284657 | ||||
TrEMBL | A0A3L6EEN2 | 1e-170 | A0A3L6EEN2_MAIZE; Agamous-like MADS-box protein AGL61 | ||||
TrEMBL | B6TW43 | 1e-170 | B6TW43_MAIZE; DNA binding protein | ||||
STRING | GRMZM5G891280_P01 | 1e-171 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1224 | 36 | 128 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24840.1 | 1e-29 | AGAMOUS-like 61 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM5G891280_P01 |
Entrez Gene | 100284657 |
Publications ? help Back to Top | |||
---|---|---|---|
|