PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM5G885329_P01 | ||||||||
Common Name | Zm.24598 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 171aa MW: 19901.2 Da PI: 9.1496 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 102.5 | 5.7e-32 | 12 | 86 | 53 | 128 |
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++ewyfF +rd+ky++g r+nrat++gyWk+tgkd+++ +++ +g+kktLv+ykgrap+g +t+Wvmheyr+ GRMZM5G885329_P01 12 GRDSEWYFFGPRDRKYPNGCRTNRATQAGYWKSTGKDRQISY-QNRSIGMKKTLVYYKGRAPQGLRTSWVMHEYRI 86 4678*************************************9.8899***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 39.726 | 1 | 109 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 8.37E-39 | 11 | 110 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.8E-16 | 15 | 86 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MFVLEEKSFL PGRDSEWYFF GPRDRKYPNG CRTNRATQAG YWKSTGKDRQ ISYQNRSIGM 60 KKTLVYYKGR APQGLRTSWV MHEYRIEESE CENTMGIQDS YALCRVFKKN VALGELQKQK 120 QGECSSSQSK EKQEQFTSIR DAGQSSGSNE HGKDNTWMQF IADDLWCNQT K |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-34 | 2 | 109 | 60 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-34 | 2 | 109 | 60 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-34 | 2 | 109 | 60 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-34 | 2 | 109 | 60 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-34 | 2 | 109 | 63 | 168 | NAC domain-containing protein 19 |
3swm_B | 1e-34 | 2 | 109 | 63 | 168 | NAC domain-containing protein 19 |
3swm_C | 1e-34 | 2 | 109 | 63 | 168 | NAC domain-containing protein 19 |
3swm_D | 1e-34 | 2 | 109 | 63 | 168 | NAC domain-containing protein 19 |
3swp_A | 1e-34 | 2 | 109 | 63 | 168 | NAC domain-containing protein 19 |
3swp_B | 1e-34 | 2 | 109 | 63 | 168 | NAC domain-containing protein 19 |
3swp_C | 1e-34 | 2 | 109 | 63 | 168 | NAC domain-containing protein 19 |
3swp_D | 1e-34 | 2 | 109 | 63 | 168 | NAC domain-containing protein 19 |
4dul_A | 1e-34 | 2 | 109 | 60 | 165 | NAC domain-containing protein 19 |
4dul_B | 1e-34 | 2 | 109 | 60 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.24598 | 0.0 | meristem| pericarp| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM5G885329 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM5G885329_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC137596 | 1e-99 | AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence. | |||
GenBank | AP005564 | 1e-99 | AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence. | |||
GenBank | AP014965 | 1e-99 | AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012617 | 1e-99 | CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008653036.1 | 1e-123 | NAC domain-containing protein 45 | ||||
Swissprot | A4VCM0 | 2e-53 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
TrEMBL | A0A1D6IAU5 | 1e-121 | A0A1D6IAU5_MAIZE; NAC domain containing protein 57 | ||||
TrEMBL | A0A3L6E437 | 1e-121 | A0A3L6E437_MAIZE; NAC domain-containing protein 86 | ||||
STRING | GRMZM5G885329_P01 | 1e-127 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3713 | 38 | 79 | Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G17730.1 | 7e-65 | NAC domain containing protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM5G885329_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|