PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM5G829103_P07 | ||||||||
Common Name | CA2P6, LOC100283565, Zm.97007 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 322aa MW: 34122.6 Da PI: 10.0538 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 99.5 | 3.5e-31 | 165 | 221 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 d+p+YVN+KQy++Il+RR +Rak+e+e++l +k+rkpylheSRh hA+rR Rg+gGrF GRMZM5G829103_P07 165 DAPIYVNPKQYEGILRRRRARAKAESENRL-AKGRKPYLHESRHLHAMRRVRGTGGRF 221 68****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.0E-34 | 163 | 224 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 35.76 | 164 | 224 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.2E-22 | 167 | 189 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.7E-27 | 167 | 221 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.2E-22 | 198 | 221 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 322 aa Download sequence Send to blast |
MMSFKGHEGF GQVAAAGAGS QAASHGGAGP LPWWAGPQLL FGEPAPPSPE ETRRDAQFQV 60 VPGVQGTPDP APPKTGTPEV LKFSVFQGNL ESGGKGEKTP KNSTTIALQS PFPEYNGRFE 120 IGLGQSMLAP SNYPCADQCY GMLAAYGMRS MSGGRMLLPL NATADAPIYV NPKQYEGILR 180 RRRARAKAES ENRLAKGRKP YLHESRHLHA MRRVRGTGGR FVNTKKEGRG TGVASNGGSK 240 TAAAAPSRLA MPPSFQSSVA SLSGSDVSNM YSGGLEQHLR APHFFTPLPP IMEDGDHGGP 300 PTRISSSFKW AASDGCCELL KA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 8e-17 | 165 | 227 | 2 | 64 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
4g91_A | 5e-17 | 165 | 222 | 2 | 60 | HAPB protein |
4g92_A | 5e-17 | 165 | 222 | 2 | 60 | HAPB protein |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.97007 | 0.0 | embryo| endosperm| meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM5G829103 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM5G829103_P07 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT036977 | 0.0 | BT036977.1 Zea mays full-length cDNA clone ZM_BFb0150B05 mRNA, complete cds. | |||
GenBank | BT041906 | 0.0 | BT041906.1 Zea mays full-length cDNA clone ZM_BFb0078A16 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008677578.1 | 0.0 | nuclear transcription factor Y subunit A-10 isoform X1 | ||||
Refseq | XP_008677580.1 | 0.0 | nuclear transcription factor Y subunit A-10 isoform X1 | ||||
TrEMBL | B4FIN9 | 0.0 | B4FIN9_MAIZE; CCAAT-HAP2 transcription factor | ||||
STRING | GRMZM5G829103_P07 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G06510.3 | 6e-28 | nuclear factor Y, subunit A10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM5G829103_P07 |
Entrez Gene | 100283565 |
Publications ? help Back to Top | |||
---|---|---|---|
|