PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM5G805387_P01 | ||||||||
Common Name | ZEAMMB73_279785 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 124aa MW: 13992.3 Da PI: 10.7783 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 86.3 | 1.7e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtfskRr+g+ KKA E+ vLCd+ev v+ifss gkly+y+s GRMZM5G805387_P01 9 KRIENSTNRQVTFSKRRAGLVKKAREIGVLCDTEVGVVIFSSGGKLYDYCS 59 79***********************************************96 PP | |||||||
2 | K-box | 22.7 | 4.2e-09 | 71 | 106 | 1 | 36 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqR 36 yq++sgk l+ +k+++l+ e++++kke++n+q ++R GRMZM5G805387_P01 71 YQTNSGKILWGEKHKNLSAEIDRVKKENDNMQIQLR 106 89999999************************9988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.258 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.11E-33 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.98E-40 | 2 | 80 | No hit | No description |
PRINTS | PR00404 | 2.1E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MGRGKIKIKR IENSTNRQVT FSKRRAGLVK KAREIGVLCD TEVGVVIFSS GGKLYDYCSP 60 RTSLSRILEK YQTNSGKILW GEKHKNLSAE IDRVKKENDN MQIQLRPVFL IQICSGSLAA 120 RALH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-20 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.336 | 0.0 | ear| endosperm| ovary| pedicel| pericarp| pollen| shoot| silk |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM5G805387 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in lodicules and stamens from early to late stage of flower development. {ECO:0000269|PubMed:10945340, ECO:0000269|Ref.1}. | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in anthers and carpels. Expressed in pollen, tapetum and stigma. {ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules (whorl 2). {ECO:0000269|PubMed:14704206}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM5G805387_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT064585 | 0.0 | BT064585.1 Zea mays full-length cDNA clone ZM_BFc0186B22 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008656271.1 | 1e-71 | MADS-box transcription factor 4-like isoform X1 | ||||
Swissprot | Q40702 | 2e-65 | MADS2_ORYSJ; MADS-box transcription factor 2 | ||||
TrEMBL | K7VFJ5 | 6e-86 | K7VFJ5_MAIZE; MADS18 | ||||
STRING | GRMZM5G805387_P03 | 5e-71 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G20240.1 | 4e-48 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM5G805387_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|