PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM5G803812_P01 | ||||||||
Common Name | HB98, LOC103626227, Zm.64576 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 348aa MW: 37530.8 Da PI: 6.4587 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 58.1 | 1.5e-18 | 120 | 172 | 4 | 56 |
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +++++ eq+++Le+ Fe +++ e++++LA+ lgL+ rqV +WFqNrRa++k GRMZM5G803812_P01 120 KRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 172 44799***********************************************9 PP | |||||||
2 | HD-ZIP_I/II | 128.3 | 3.3e-41 | 118 | 210 | 1 | 93 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 e+krrls eqv++LE+sFe +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aL+r++da ++en++L +++++L++e++ GRMZM5G803812_P01 118 ERKRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALRRQLDAARAENDALLSHNKKLQTEIM 209 69**************************************************************************************9987 PP HD-ZIP_I/II 93 e 93 + GRMZM5G803812_P01 210 A 210 5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-19 | 93 | 175 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.46E-19 | 112 | 176 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.957 | 114 | 174 | IPR001356 | Homeobox domain |
SMART | SM00389 | 2.5E-18 | 117 | 178 | IPR001356 | Homeobox domain |
CDD | cd00086 | 5.16E-18 | 119 | 175 | No hit | No description |
Pfam | PF00046 | 8.3E-16 | 120 | 172 | IPR001356 | Homeobox domain |
PRINTS | PR00031 | 5.0E-6 | 145 | 154 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 149 | 172 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 5.0E-6 | 154 | 170 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 2.9E-12 | 174 | 213 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 348 aa Download sequence Send to blast |
MKPMATNGMA PSFFAANFLL QMQQEQQAHH QHQHHEGHDH LLAPPPPALV SPFLHDFGGA 60 MTAPPPPMLA TGIKRMYPDG MCDDGSGHLH AEPKQHQQDC GGGASDDEEG SAAAACGERK 120 RRLSVEQVRT LERSFEVANK LEPERKAQLA RALGLQPRQV AIWFQNRRAR WKTKQLEKDY 180 DALRRQLDAA RAENDALLSH NKKLQTEIMA LKGGGGGRQE AASELINLNV KETEASCSNR 240 SSDENSSEIN LDISRPPRAA DESPAAMDSY RGIPFYACAR ADDVDQLQLL HSGGHPSPAP 300 KMEPGHGAAA TAGGGGGGGG TFGSLLCGAA ADEQPPFWPW ADGHHAFQ |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 117 | 122 | ERKRRL |
2 | 166 | 174 | RRARWKTKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.64576 | 0.0 | endosperm| silk |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM5G803812 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and panicles. {ECO:0000269|PubMed:17999151}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and panicles. {ECO:0000269|PubMed:17999151}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM5G803812_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728412 | 0.0 | KJ728412.1 Zea mays clone pUT6717 HB transcription factor (HB98) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001339824.1 | 0.0 | homeobox-leucine zipper protein HOX23 | ||||
Swissprot | A2Z734 | 2e-92 | HOX23_ORYSI; Homeobox-leucine zipper protein HOX23 | ||||
Swissprot | Q94GL5 | 2e-92 | HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23 | ||||
TrEMBL | A0A060D8B1 | 0.0 | A0A060D8B1_MAIZE; HB transcription factor (Fragment) | ||||
STRING | GRMZM5G803812_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2289 | 38 | 94 | Representative plant | OGRP129 | 16 | 189 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69780.1 | 3e-43 | HD-ZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM5G803812_P01 |
Entrez Gene | 103626227 |
Publications ? help Back to Top | |||
---|---|---|---|
|