PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM5G803355_P01 | ||||||||
Common Name | LOC100285488 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 225aa MW: 25246.7 Da PI: 10.7761 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52 | 1.6e-16 | 14 | 59 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed++l ++v ++G+++W++Ia+ + gR++k+c++rw++ GRMZM5G803355_P01 14 RGHWRPGEDDKLRQLVDKYGPRNWNSIAESLE-GRSGKSCRLRWFNQ 59 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 51.3 | 2.7e-16 | 66 | 110 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r ++T E+ell++a++ +G++ W+ I+r ++ gRt++ +k++w+ + GRMZM5G803355_P01 66 RRPFTVAEEELLLRAHRAHGNR-WAIISRLFP-GRTDNAVKNHWHVV 110 679*******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.162 | 9 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.67E-29 | 13 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-13 | 13 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-16 | 14 | 59 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-25 | 15 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.15E-13 | 17 | 58 | No hit | No description |
PROSITE profile | PS51294 | 24.933 | 61 | 115 | IPR017930 | Myb domain |
SMART | SM00717 | 5.0E-15 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-13 | 66 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.31E-11 | 68 | 111 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-19 | 68 | 113 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 225 aa Download sequence Send to blast |
MEKEKEKSRA RPSRGHWRPG EDDKLRQLVD KYGPRNWNSI AESLEGRSGK SCRLRWFNQL 60 DPRINRRPFT VAEEELLLRA HRAHGNRWAI ISRLFPGRTD NAVKNHWHVV MARRRRRTLV 120 GEAAAIGSVV VPPRHQYFHF GSCSPPPPTR SLCFAVPAGF GPLGLSRPAA SCGVRNCNVP 180 TAVALLDDGH RHDMSKDLGG DDDNGGDALA KRKDVQFFDF LGVGI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 4e-31 | 14 | 114 | 4 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 4e-31 | 14 | 114 | 4 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 4e-31 | 14 | 114 | 4 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 112 | 117 | RRRRRT |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM5G803355 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21399993}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM5G803355_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU972498 | 0.0 | EU972498.1 Zea mays clone 382267 myb-like DNA-binding domain containing protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001151853.1 | 1e-166 | uncharacterized protein LOC100285488 | ||||
Swissprot | Q6R0C4 | 2e-57 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A3L6FJK2 | 1e-164 | A0A3L6FJK2_MAIZE; Transcription factor MYB105 | ||||
TrEMBL | B6U5I3 | 1e-164 | B6U5I3_MAIZE; Myb-like DNA-binding domain containing protein | ||||
STRING | GRMZM5G803355_P01 | 1e-165 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP294 | 38 | 260 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69560.1 | 3e-58 | myb domain protein 105 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM5G803355_P01 |
Entrez Gene | 100285488 |
Publications ? help Back to Top | |||
---|---|---|---|
|