PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G553379_P07 | ||||||||
Common Name | m15 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 247aa MW: 28163.2 Da PI: 9.3662 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.3 | 1.5e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyeys+ GRMZM2G553379_P07 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 105.3 | 7.2e-35 | 78 | 171 | 4 | 97 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 + s+e++++ ++++e++kLk+++e++q+ q+hl+GedLe+L+lkeLqqLeqqLe+slk+iR++Kn+l+le+i+elq+kek+lqeenk L+ GRMZM2G553379_P07 78 KVLISAESETQGNWCHEYRKLKAKVETIQKCQKHLMGEDLETLNLKELQQLEQQLESSLKHIRTRKNQLMLESISELQRKEKSLQEENKVLQ 169 555667888999*******************************************************************************9 PP K-box 96 kk 97 k+ GRMZM2G553379_P07 170 KE 171 86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.6E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.165 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.58E-41 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 6.28E-35 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-29 | 84 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.179 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLYEYSTD 60 SCMDKILDRY ERYSYAEKVL ISAESETQGN WCHEYRKLKA KVETIQKCQK HLMGEDLETL 120 NLKELQQLEQ QLESSLKHIR TRKNQLMLES ISELQRKEKS LQEENKVLQK EKALLLPAAR 180 GEAESPAEAS AMGPNPTADQ FVFLVLRDKG SCPNNKYQHF SCGSRREVGG RCSSAATGSR 240 WTTTMDA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.1206 | 0.0 | ear| endosperm| meristem| ovary| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G553379 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) apical meristem and later in developing stamens, pistil primordia and differentiated anthers. | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in sterile lemmas, at intermediate levels in stamens, and weakly in lemmas, paleas and carpels. {ECO:0000269|PubMed:10444103}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|Ref.9}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G553379_P07 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ430632 | 0.0 | AJ430632.1 Zea mays mRNA for putative MADS-domain transcription factor (m15 gene). | |||
GenBank | BT065993 | 0.0 | BT065993.1 Zea mays full-length cDNA clone ZM_BFb0138G13 mRNA, complete cds. | |||
GenBank | KJ726927 | 0.0 | KJ726927.1 Zea mays clone pUT3472 MADS transcription factor (MADS15) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008644264.1 | 0.0 | m15 protein isoform X2 | ||||
Swissprot | Q10CQ1 | 1e-105 | MAD14_ORYSJ; MADS-box transcription factor 14 | ||||
TrEMBL | A0A287SDC9 | 1e-115 | A0A287SDC9_HORVV; Uncharacterized protein | ||||
STRING | GRMZM2G553379_P07 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1151 | 37 | 113 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-77 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G553379_P07 |
Entrez Gene | 542032 |