PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G553379_P05
Common Namem15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 183aa    MW: 21366.8 Da    PI: 10.1247
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G553379_P05genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF1009e-32959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyeys+
  GRMZM2G553379_P05  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEYST 59
                       79***********************************************96 PP

2K-box965.8e-3278160486
              K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                        +   s+e++++ ++++e++kLk+++e++q+ q+hl+GedLe+L+lkeLqqLeqqLe+slk+iR++Kn+l+le+i+elq+k ++
  GRMZM2G553379_P05  78 KVLISAESETQGNWCHEYRKLKAKVETIQKCQKHLMGEDLETLNLKELQQLEQQLESSLKHIRTRKNQLMLESISELQRKVNS 160
                        556667889999********************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.6E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.165161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-35289IPR002100Transcription factor, MADS-box
CDDcd002653.25E-40276No hitNo description
PRINTSPR004043.0E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-323859IPR002100Transcription factor, MADS-box
PfamPF014865.3E-2684160IPR002487Transcription factor, K-box
PROSITE profilePS5129714.55388172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLYEYSTD  60
SCMDKILDRY ERYSYAEKVL ISAESETQGN WCHEYRKLKA KVETIQKCQK HLMGEDLETL  120
NLKELQQLEQ QLESSLKHIR TRKNQLMLES ISELQRKVNS SSLLKVGRWN FLFKKCKVSL  180
AGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A2e-23174173MEF2 CHIMERA
6bz1_B2e-23174173MEF2 CHIMERA
6bz1_C2e-23174173MEF2 CHIMERA
6bz1_D2e-23174173MEF2 CHIMERA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.12060.0ear| endosperm| meristem| ovary| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G553379
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) apical meristem and later in developing stamens, pistil primordia and differentiated anthers.
UniprotTISSUE SPECIFICITY: Highly expressed in sterile lemmas, at intermediate levels in stamens, and weakly in lemmas, paleas and carpels. {ECO:0000269|PubMed:10444103}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|Ref.9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G553379_P05
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306320.0AJ430632.1 Zea mays mRNA for putative MADS-domain transcription factor (m15 gene).
GenBankBT0659930.0BT065993.1 Zea mays full-length cDNA clone ZM_BFb0138G13 mRNA, complete cds.
GenBankKJ7269270.0KJ726927.1 Zea mays clone pUT3472 MADS transcription factor (MADS15) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644265.11e-124m15 protein isoform X3
SwissprotQ10CQ13e-96MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBLQ84V791e-109Q84V79_MAIZE; MADS transcription factor
STRINGGRMZM2G553379_P071e-109(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.14e-73MIKC_MADS family protein
Publications ? help Back to Top
  1. Jia H, et al.
    Characterization and transcriptional profiles of two rice MADS-box genes.
    Plant Sci., 2000. 155(2): p. 115-122
    [PMID:10814814]
  2. Jang S,An K,Lee S,An G
    Characterization of tobacco MADS-box genes involved in floral initiation.
    Plant Cell Physiol., 2002. 43(2): p. 230-8
    [PMID:11867703]
  3. Kim SL,Lee S,Kim HJ,Nam HG,An G
    OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a.
    Plant Physiol., 2007. 145(4): p. 1484-94
    [PMID:17951465]
  4. Li D, et al.
    Functional characterization of rice OsDof12.
    Planta, 2009. 229(6): p. 1159-69
    [PMID:19198875]
  5. Tanaka N, et al.
    The COP1 ortholog PPS regulates the juvenile-adult and vegetative-reproductive phase changes in rice.
    Plant Cell, 2011. 23(6): p. 2143-54
    [PMID:21705640]
  6. Kobayashi K, et al.
    Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene.
    Plant Cell, 2012. 24(5): p. 1848-59
    [PMID:22570445]
  7. Wei X, et al.
    Fine mapping of BH1, a gene controlling lemma and palea development in rice.
    Plant Cell Rep., 2013. 32(9): p. 1455-63
    [PMID:23689259]
  8. Su L,Shan JX,Gao JP,Lin HX
    OsHAL3, a Blue Light-Responsive Protein, Interacts with the Floral Regulator Hd1 to Activate Flowering in Rice.
    Mol Plant, 2016. 9(2): p. 233-244
    [PMID:26537047]
  9. Wu F, et al.
    The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses.
    Plant J., 2017. 89(2): p. 310-324
    [PMID:27689766]