PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G516301_P01 | ||||||||
Common Name | WRKY80, ZEAMMB73_768940, Zm.162261 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 229aa MW: 24138.9 Da PI: 7.8398 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 95.7 | 3.2e-30 | 120 | 178 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+ +gC vkk+ver+++dp++v++tY g Hnh GRMZM2G516301_P01 120 LDDGFKWRKYGKKAVKSSPNPRNYYRCSAEGCGVKKRVERDSDDPRYVVTTYDGVHNHA 178 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.0E-31 | 108 | 180 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-27 | 112 | 180 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.938 | 115 | 180 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.9E-34 | 120 | 179 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.3E-24 | 121 | 177 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MAASLGLAHE AAPFYAAAYP PAGAAYAYLA PPPGDLVVEF PPRAATMADD CCYQFGQEMG 60 GAYCSPPVFD NGMTSLLNYG VEGDGRRPVG GPAGGTGNGG GRPRPASRIG FRTRSEVDVL 120 DDGFKWRKYG KKAVKSSPNP RNYYRCSAEG CGVKKRVERD SDDPRYVVTT YDGVHNHAAP 180 GAAYLCPPPP PRGAAHYSPP VAAPSWSAAL DAWEAQLHRH AAAAAHSSE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-27 | 110 | 180 | 7 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 5e-27 | 110 | 180 | 7 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G516301 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G516301_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT064620 | 0.0 | BT064620.1 Zea mays full-length cDNA clone ZM_BFc0191G11 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001344470.1 | 1e-165 | uncharacterized protein LOC100384623 | ||||
TrEMBL | C0P8K1 | 1e-164 | C0P8K1_MAIZE; Putative WRKY transcription factor 50 | ||||
STRING | GRMZM2G516301_P01 | 1e-165 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 3e-37 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G516301_P01 |