PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G473152_P01 | ||||||||
Common Name | LOC103650792, Zm.133751 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 179aa MW: 18913 Da PI: 6.7363 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171.9 | 6.8e-54 | 28 | 123 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++ a++ lGf+dyv+p++ yl+kyrel GRMZM2G473152_P01 28 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCCAFGALGFDDYVDPMRRYLHKYREL 119 89****************************************************************************************** PP NF-YB 94 egek 97 eg++ GRMZM2G473152_P01 120 EGDR 123 **97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.0E-49 | 24 | 128 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.9E-38 | 30 | 127 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-26 | 33 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.9E-16 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.9E-16 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 1.9E-16 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MADHHHHHHH GHPPDGPGGA GDQLEVIKEQ DRLLPIANVG RIMKQILPPN AKISKEAKET 60 MQECVSEFIS FVTGEASDKC HKEKRKTVNG DDVCCAFGAL GFDDYVDPMR RYLHKYRELE 120 GDRAASSRGG GGGPAGAADP ASASAAAGPS PSAASAGHFM FGAAMDRPDN NSSAGARPF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-43 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-43 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G473152 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G473152_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU970198 | 0.0 | EU970198.1 Zea mays clone 342117 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008674580.1 | 1e-129 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | O82248 | 2e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1D6N242 | 1e-128 | A0A1D6N242_MAIZE; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A3L6FL70 | 1e-128 | A0A3L6FL70_MAIZE; Nuclear transcription factor Y subunit B-5 | ||||
STRING | GRMZM2G473152_P01 | 1e-129 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 6e-55 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G473152_P01 |
Entrez Gene | 103650792 |
Publications ? help Back to Top | |||
---|---|---|---|
|