PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G465835_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 272aa    MW: 30229.6 Da    PI: 7.1793
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G465835_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM131.37e-4151412127
                NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk..........kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                        +pGfrF Pt+eel+++yL++k++g++  ++e+vi+ +d+++++PwdL +          +++++e+ w++F++r++++a+g r++r+t sgy
  GRMZM2G465835_P01   5 APGFRFYPTEEELICFYLRNKLSGTRrADIERVIPVADVCTLDPWDLISgtfirqahrgACSGNEEPWFYFCPRQEREARGGRPSRTTPSGY 96 
                        69*********************9987888889**************74578887776645557889************************* PP

                NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                        Wka g+   v++++g+ +g+kkt+vfy+grap g kt+W ++ey+
  GRMZM2G465835_P01  97 WKAAGTPGLVYAADGRPIGTKKTMVFYRGRAPAGAKTKWKLNEYK 141
                        ********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-443176IPR003441NAC domain
PROSITE profilePS5100544.6054176IPR003441NAC domain
PfamPF023653.4E-226141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAEFAPGFRF YPTEEELICF YLRNKLSGTR RADIERVIPV ADVCTLDPWD LISGTFIRQA  60
HRGACSGNEE PWFYFCPRQE REARGGRPSR TTPSGYWKAA GTPGLVYAAD GRPIGTKKTM  120
VFYRGRAPAG AKTKWKLNEY KAFEDDDATA AVAAPAPPSH ALQTWSQYSL CRLYTKSGCL  180
RQFDRRRSST AAATGGGNEN KPPAPSTALP DGDQTGQKRK RAAPTDDTSS SYEDGDEDVS  240
TQQRLRLAQR GADDEGVKDM TDWWSEFLDD CI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-28617619165NO APICAL MERISTEM PROTEIN
1ut4_B5e-28617619165NO APICAL MERISTEM PROTEIN
1ut7_A5e-28617619165NO APICAL MERISTEM PROTEIN
1ut7_B5e-28617619165NO APICAL MERISTEM PROTEIN
4dul_A5e-28617619165NAC domain-containing protein 19
4dul_B5e-28617619165NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G465835
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G465835_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021303937.11e-134NAC domain-containing protein 90
SwissprotQ9FMR31e-59NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A1D6M5320.0A0A1D6M532_MAIZE; Putative NAC domain transcription factor superfamily protein
STRINGGRMZM2G465835_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Representative plantOGRP22781136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-59NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]