PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G453001_P01
Common NameLOC103631747, Zm.126322
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family STAT
Protein Properties Length: 704aa    MW: 77841 Da    PI: 5.9424
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G453001_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT188.38.9e-592283481121
               STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveks.ddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipk 91 
                        l+vvl+na+g+pv kd+evv+sL+yad+g+vv+ks dd+e+pLLi+++G+e+++ +rpl+++rGra+fklkisqLsskcdn+Lfrikf++++
  GRMZM2G453001_P01 228 LEVVLTNAFGEPV-KDKEVVSSLVYADDGTVVAKSrDDSEPPLLITCEGLEYAAISRPLPIIRGRALFKLKISQLSSKCDNKLFRIKFSTLH 318
                        79**********9.*********************9******************************************************** PP

               STAT  92 lkkypfleavskpirCisrsrntrsssltk 121
                        +++y+flea+skpirCisrsr++r+++ tk
  GRMZM2G453001_P01 319 MQRYSFLEAYSKPIRCISRSRTVRPLGPTK 348
                        ************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498993.31E-533163IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF555503.85E-6600684IPR000980SH2 domain
PROSITE profilePS500019.426606704IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MAAPESECGG SDGYRDLRGV RVDLDTGAAR AGGGGGFAVS FWLYLSVSAR PSSVILHQIT  60
AGDDTKLPFL ALGEGNKLLL FPLMRLHREA PAPASSYPWT DTTNLSSTSV CPLEKWFHIG  120
CEVTENVMRL HVDGFLTAEA PLCSLFDEPD SQDDSNQISL VGNDGKLEGY IYNIEVSYVL  180
GAIKEQYTKN PPFKLSIDYS CSDGIEEGDD GIWSIVGGKA SCRRNFILEV VLTNAFGEPV  240
KDKEVVSSLV YADDGTVVAK SRDDSEPPLL ITCEGLEYAA ISRPLPIIRG RALFKLKISQ  300
LSSKCDNKLF RIKFSTLHMQ RYSFLEAYSK PIRCISRSRT VRPLGPTKRA SSATANEIDM  360
LSNGQGFVST DKVNSRGHSV CLHTPMFPKI EDGMVEVVEA HKIVSQNKNA RKVVVSKEAQ  420
NVIGTDSSTS NYDSFDSGSS WSGSEGDDGI ETFSDAVVFR YCLDSTYDRS KFLRGASLTV  480
NKDDLVKLAD RVSLYSGCSH HRNQILMSKR LLREGADTWN MISKNNERAL WSSAIPEIIT  540
KFTNIAHSVR RGLSEQDLEV LRGIAGCGED IGRDEFDRLW CWLYPVAVSL SRERIKKLWD  600
CTAPRWIEGL ITTEEAESAL RSSRELLKEA GTFVLRFPIT RSWPHPDAGS LVVTYIGSDS  660
SIHHRLLSLD SSDASAEKLQ DLLLQEPELS QLGRVDRVSI TIRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.239280.0embryo| meristem| ovary| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G453001
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G453001_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008651236.10.0SH2 domain-containing protein B isoform X2
TrEMBLA0A1D6JPB80.0A0A1D6JPB8_MAIZE; SH2 domain protein B
TrEMBLA0A317YAD50.0A0A317YAD5_MAIZE; Uncharacterized protein
STRINGGRMZM2G453001_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75473135
Representative plantOGRP59411618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-149SH2 domain protein B