PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G446515_P05
Common NameLOC100192608
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family BES1
Protein Properties Length: 679aa    MW: 75680.4 Da    PI: 5.2004
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G446515_P05genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822121.79.8e-3846121176
             DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 
                        g+s r++  +E+E++k RER+RRai+ +i+aGLR++Gny+l++raD+neV++AL+reAGwvv +DGtt++ +s+  
  GRMZM2G446515_P05  46 GTSNRRRAREEKERTKMRERQRRAITGRILAGLRQHGNYRLRARADINEVIAALAREAGWVVLPDGTTFPSSSSFA 121
                        57899*****************************************************************777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.4E-3448129IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514455.62E-190236675IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.801.7E-207239673IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.6E-114245662IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-77276290IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-77297315IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-77319340IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060323331IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR008425.5E-8402411IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007502.3E-77412434IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-77485504IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-77519535IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-77536547IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-77554577IPR001554Glycoside hydrolase, family 14
PRINTSPR008425.5E-8557567IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007502.3E-77594616IPR001554Glycoside hydrolase, family 14
PRINTSPR008425.5E-8645659IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008425.5E-8660674IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MQQAGLADDD DEEIWVKEED DEEEEDGYYM DPRSPAVWTP GGRAGGTSNR RRAREEKERT  60
KMRERQRRAI TGRILAGLRQ HGNYRLRARA DINEVIAALA REAGWVVLPD GTTFPSSSSF  120
AAVAAQPPRP VMVAAASPSA TPLALPASSA LPLRGIAPVA ARPISHRPAP AFALLLPPRA  180
AAASRSPADD VPDGNSSHLL AVPVPVPMDP AAAEDVPVAK QLQVPDVSPR PPERDFAGTP  240
YVPVYVMLPL GVVNGNGEVV DADELVGQLR VLKASGVDGV MVDCWWGNVE AHKPQEYNWT  300
GYRRLFQMIR ELKLKLQVVM SFHECGGNVG DDISIPLPHW VIEIGRSNPD IYFTDRAGRR  360
NTECLSWGVD KERVLQGRTA VEVYFDFMRS FRVEFDEYFE DGIISEIEIG LGACGELRYP  420
SYPAKHGWKY PGIGEFQCYD RYLQKSLRKA AEARGHTIWA RGPDNAGHYN SEPNLTGFFC  480
DGGDYDSYYG RFFLSWYSQA LVDHADRVLM LARLAFEGTN IAVKVSGVHW WYKTASHAAE  540
LTAGFYNPCN RDGYAPIAAV LKKYDAALNF TCVELRTMDQ HEVYPEAFAD PEGLVWQVLN  600
AAWDAGIQVA SENALPCYDR DGFNKILENA KPLNDPDGRH LLGFTYLRLG KDLFERPNFF  660
EFERFIKRMH GEAVLDLQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1bfn_A1e-16224167211444BETA-AMYLASE
1bya_A1e-16224167211444BETA-AMYLASE
1byb_A1e-16224167211444BETA-AMYLASE
1byc_A1e-16224167211444BETA-AMYLASE
1byd_A1e-16224167211444BETA-AMYLASE
1q6c_A1e-16224167211444beta-amylase
1wdp_A1e-16224167211444Beta-amylase
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.298680.0cell culture| endosperm| meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G446515
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G446515_P05
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9569050.0EU956905.1 Zea mays clone 1577050 beta-amylase mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001337631.10.0uncharacterized protein LOC100278364
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A1D6I0960.0A0A1D6I096_MAIZE; Beta-amylase
STRINGGRMZM2G446515_P050.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21413663
Representative plantOGRP4345912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7
Publications ? help Back to Top
  1. Soyk S, et al.
    The Enzyme-Like Domain of Arabidopsis Nuclear β-Amylases Is Critical for DNA Sequence Recognition and Transcriptional Activation.
    Plant Cell, 2014. 26(4): p. 1746-1763
    [PMID:24748042]