PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G431243_P01
Common NameZEAMMB73_058713, Zm.9880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CAMTA
Protein Properties Length: 949aa    MW: 106156 Da    PI: 6.533
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G431243_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1144.43.1e-4528634118
               CG-1  34 pksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                        p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLK g+++vl+cyYah+een++fqrr+ywlLee++++ivlvhylevk
  GRMZM2G431243_P01   2 PRSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEENENFQRRTYWLLEEDFTHIVLVHYLEVK 86 
                        89********************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143763.479191IPR005559CG-1 DNA-binding domain
SMARTSM010768.3E-45186IPR005559CG-1 DNA-binding domain
PfamPF038592.6E-38285IPR005559CG-1 DNA-binding domain
CDDcd001028.44E-4358446No hitNo description
Gene3DG3DSA:2.60.40.102.9E-9358446IPR013783Immunoglobulin-like fold
SuperFamilySSF812962.96E-18359445IPR014756Immunoglobulin E-set
PfamPF018339.0E-8359442IPR002909IPT domain
SuperFamilySSF484031.87E-15536651IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.8E-16547652IPR020683Ankyrin repeat-containing domain
CDDcd002049.31E-13551649No hitNo description
PROSITE profilePS5029717.953557651IPR020683Ankyrin repeat-containing domain
PfamPF127964.4E-7563652IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008810.286590622IPR002110Ankyrin repeat
SMARTSM002480.076590619IPR002110Ankyrin repeat
SMARTSM00248970629658IPR002110Ankyrin repeat
SuperFamilySSF525404.78E-8759814IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.045763785IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.791764793IPR000048IQ motif, EF-hand binding site
PfamPF006120.0051765784IPR000048IQ motif, EF-hand binding site
SMARTSM000150.012786808IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.249787811IPR000048IQ motif, EF-hand binding site
PfamPF006124.9E-4789808IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 949 aa     Download sequence    Send to blast
MPRSGSLFLF DRKVLRYFRK DGHNWRKKKD GKTVKEAHEK LKAGSIDVLH CYYAHGEENE  60
NFQRRTYWLL EEDFTHIVLV HYLEVKGCKQ SFNRVKEELM QLSNVDSPSC SNSITSQNQM  120
GPQNMEAAES PISGQISEYE DTESDNCRAS SRYHPLAEMQ QLVDGVITEN MLYPSASTVG  180
SRQGYHGEML PITDNLDNRS FSNHDIARML DGANIGLSDV SSTLFDSVPF NEPFTNYSAG  240
FTEPTLHSSF ACLEANDLDD SSCLQTFTSE ALYTNHLNQK EADALGFTGI LASEVNRDRY  300
NDGSIKHSLL KQSSLDLLTI EAPGLKKNDS FSRWMSKELE ELDAYVVNPS LSQDQLFSIL  360
DVSPSCAYIG TNTKVSVTGT FLVNKKHVES HRWSCMFGDV EVPAEVLTDG TLRCYAPAHQ  420
SGRVPFYVTC SNRVACSEVR EFEYRDSEAH YMETSRSQAN GVNEMHLHIR LEKLLTLGPD  480
DHQMLVISSG NEKYEIMNAI NSLMLDGKWS NQESSVKEVV STARVQSLKK LVKEKLHQWL  540
ICKVNDDGKG PNVLCKEGQG VIHLVAALGY DWAIRPIMIA GVNVNFRDAH GWTALHWAAS  600
LGRERTVSVL IANGAAAGAL TDPTSEFPSG RSPADLASVN GHKGIAGFLA ESALTSHLSA  660
LTIRESNDST VEACGLPFAE DLTGIDSVHL AGEGPDAESL EGSLSAVRKS TQAAARIFQA  720
FRVESFHRKK VVEYGDDTCG LSDECTLSLV SLKNVKPGQH DTHLHSAAVR IQNKFRGWKG  780
RKEFMIIRQR IVKLQAHVRG HQVRKNYRKV VWSVGIVEKV ILRWRRKRPG LRGFRPEKQL  840
EGPSQIQPAK AEDEYDFLHD GRRQAEARLQ RALARVHSMS QYPEAREQYH RLTTCVAEMK  900
QSRMMQDEML SQAAGGADDF MAGLEDLICI DDAPPRCLPF GEAEPFYIR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.964940.0endosperm| meristem| root| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G431243
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G431243_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9570630.0EU957063.1 Zea mays clone 1581734 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008660007.10.0calmodulin-binding transcription activator 1 isoform X2
TrEMBLA0A1D6P7T80.0A0A1D6P7T8_MAIZE; Calmodulin-binding transcription activator 2
STRINGGRMZM2G431243_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60838140
Representative plantOGRP5621565
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.20.0ethylene induced calmodulin binding protein