PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G431156_P02 | ||||||||
Common Name | LOC100384181, ZEAMMB73_660042 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 249aa MW: 27180.8 Da PI: 8.6916 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.6 | 1.2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv +++ +G g+W++ ++ g+ R++k+c++rw +yl GRMZM2G431156_P02 14 KGAWTKEEDERLVAYIRSHGEGCWRSLPSAAGLLRCGKSCRLRWMNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 49.3 | 1.1e-15 | 67 | 146 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT..................................-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg..................................tWktIartmgkgRtlkqcksrwqky 47 rg++T +Edel+++++++lG++ +W++Ia ++ gRt++++k++w+++ GRMZM2G431156_P02 67 RGNFTDDEDELIIRLHALLGNKfvsrlpsvdetasffsvstfifstalpdvtrrarRWSLIAGQLP-GRTDNEIKNYWNTH 146 89****************************************************************.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.428 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.77E-22 | 15 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.11E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 11.375 | 66 | 151 | IPR017930 | Myb domain |
SMART | SM00717 | 6.7E-14 | 66 | 149 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-12 | 67 | 146 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.95E-7 | 69 | 147 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.0E-24 | 69 | 87 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 4.79E-8 | 122 | 156 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.0E-24 | 123 | 151 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MGRSPCCEKG HTNKGAWTKE EDERLVAYIR SHGEGCWRSL PSAAGLLRCG KSCRLRWMNY 60 LRPDLKRGNF TDDEDELIIR LHALLGNKFV SRLPSVDETA SFFSVSTFIF STALPDVTRR 120 ARRWSLIAGQ LPGRTDNEIK NYWNTHIKRK LLARGIDPHA HHRPQALHHV AAAALVPAPA 180 AKPKPKPAES SDDGGRSSCS CSGSGSSAGE PRCPDLNLDL SVGPPDAPTS PPPPCLCHRA 240 WEACGCQAG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-22 | 14 | 151 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.161235 | 1e-131 | endosperm| meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G431156 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269|PubMed:1840903}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G431156_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT069411 | 0.0 | BT069411.1 Zea mays full-length cDNA clone ZM_BFb0130K10 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001170228.1 | 0.0 | uncharacterized LOC100384181 | ||||
Swissprot | P81393 | 8e-81 | MYB08_ANTMA; Myb-related protein 308 | ||||
TrEMBL | C0PM92 | 0.0 | C0PM92_MAIZE; Transcription repressor MYB6 | ||||
STRING | GRMZM2G431156_P02 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09460.1 | 2e-75 | myb domain protein 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G431156_P02 |
Entrez Gene | 100384181 |
Publications ? help Back to Top | |||
---|---|---|---|
|