PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G430522_P03 | ||||||||
Common Name | Zm.4437 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 418aa MW: 46454.1 Da PI: 7.3241 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 167.3 | 5.3e-52 | 89 | 216 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrFhPtdeelv++yL++kv + + i+evd++++ePw+Lp +++ +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd+ev GRMZM2G430522_P03 89 LPPGFRFHPTDEELVTFYLAAKVFNGACCG-IDIAEVDLNRCEPWELPDAARMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATGKDREV 179 79************************9777.56***************8888899************************************* PP NAM 93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 l++ +g+l g+kktLvfykgrap+gekt+Wv+heyrl GRMZM2G430522_P03 180 LNAaTGALLGMKKTLVFYKGRAPRGEKTKWVLHEYRL 216 *9878899***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.76E-59 | 79 | 262 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.398 | 89 | 262 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.7E-27 | 90 | 216 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010014 | Biological Process | meristem initiation | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009074 | anatomy | style | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 418 aa Download sequence Send to blast |
MVLWRTGGAW WCYLARAPHY KAPPHTIPQL RASSHHLVER KSESEIDLTT CLRSKPLCMH 60 HHHQDQAMGD ALWDLLGEEM AAAGGEHGLP PGFRFHPTDE ELVTFYLAAK VFNGACCGID 120 IAEVDLNRCE PWELPDAARM GEREWYFFSL RDRKYPTGLR TNRATGAGYW KATGKDREVL 180 NAATGALLGM KKTLVFYKGR APRGEKTKWV LHEYRLDGDF AAARRPCKEY SFCVCIHQWH 240 YNSWCKHDDA LEEWVICRIL HKAGDQYSKL MMVKSPYYLP MAMDPSSFCF QEDPTGHPLP 300 NPSGCTPFHH GHPHHSMQPP PPLPPSNHAG KAVFTGAAAA CCMQQEPADG SNSAVLPMPP 360 FPPFTPIVAG KPAAPAPPPQ VVNAGPQEPP PPTWLEAYLQ HTGGILYEMG PTAAPRGA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-45 | 89 | 262 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-45 | 89 | 262 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-45 | 89 | 262 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-45 | 89 | 262 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-45 | 89 | 262 | 20 | 168 | NAC domain-containing protein 19 |
3swm_B | 3e-45 | 89 | 262 | 20 | 168 | NAC domain-containing protein 19 |
3swm_C | 3e-45 | 89 | 262 | 20 | 168 | NAC domain-containing protein 19 |
3swm_D | 3e-45 | 89 | 262 | 20 | 168 | NAC domain-containing protein 19 |
3swp_A | 3e-45 | 89 | 262 | 20 | 168 | NAC domain-containing protein 19 |
3swp_B | 3e-45 | 89 | 262 | 20 | 168 | NAC domain-containing protein 19 |
3swp_C | 3e-45 | 89 | 262 | 20 | 168 | NAC domain-containing protein 19 |
3swp_D | 3e-45 | 89 | 262 | 20 | 168 | NAC domain-containing protein 19 |
4dul_A | 3e-45 | 89 | 262 | 17 | 165 | NAC domain-containing protein 19 |
4dul_B | 3e-45 | 89 | 262 | 17 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.4437 | 0.0 | ear| meristem| shoot| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G430522 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First expressed at the globular stage, mostly in the apical part of the embryo. During the triangular stage, confined to the boundary of emerging cotyledons. Later restricted to the center of the apical part of the embryo and to seedling apex, at the boundaries of the cotyledon margins and the boundaries between the SAM and the cotyledons. Localized in a one-cell-wide ring at the boundary between trichomes or lateral roots and epidermis. Accumulates at the boundaries between leaf primordia and the shoot meristem and between floral primordia and the inflorescence meristem. Found in the adaxial axils of secondary inflorescences and pedicels, and in axiallary buds. In flowers, expressed in a ring at the bases of sepals and petals. In carpels, confined to the boundaries between ovule primordia. In ovules, localized in a ring at the boundary between the nucellus and the chalaza. In the mature embryo sac, detected in the two polar nuclei of the central cell. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}. | |||||
Uniprot | TISSUE SPECIFICITY: In a general manner, present at the boundaries between mersitems and araising primordia. {ECO:0000269|PubMed:12837947}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00241 | DAP | Transfer from AT1G76420 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G430522_P03 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT061270 | 0.0 | BT061270.1 Zea mays full-length cDNA clone ZM_BFb0128J16 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008663651.1 | 0.0 | protein CUP-SHAPED COTYLEDON 1 isoform X2 | ||||
Swissprot | Q9S851 | 1e-82 | NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3 | ||||
TrEMBL | A0A1D6KIZ7 | 0.0 | A0A1D6KIZ7_MAIZE; Protein CUP-SHAPED COTYLEDON 3 | ||||
STRING | GRMZM2G430522_P01 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76420.1 | 3e-80 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G430522_P03 |
Publications ? help Back to Top | |||
---|---|---|---|
|