PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G414805_P06 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 206aa MW: 21989.5 Da PI: 9.3233 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 70.7 | 2.8e-22 | 160 | 206 | 2 | 48 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 CqvegC++dls+ak+y+r+hkvC vhska++v+v+gle+rfCqqCsr GRMZM2G414805_P06 160 CQVEGCKVDLSSAKDYNRKHKVCVVHSKATKVVVAGLERRFCQQCSR 206 **********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.4E-22 | 152 | 206 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.529 | 157 | 206 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 6.67E-21 | 158 | 206 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.9E-16 | 160 | 206 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MGSFGMNWNQ KDPMVWDWEH LVPSVSNAVT RHGSANSSGG TLTSNSELGH GSSKSSISAS 60 IDSPSGVGNS LEFNFAAVER HVKNTGTNGR VDDSGNSPSS MIAFNQGEPL ISLKLGKRAY 120 FENACGGQDA KVSAASDVTS AASVVKKTKV SQQNAKNWYC QVEGCKVDLS SAKDYNRKHK 180 VCVVHSKATK VVVAGLERRF CQQCSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 3e-16 | 160 | 206 | 6 | 52 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.26561 | 0.0 | ear| meristem| pericarp| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G414805 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G414805_P06 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT083872 | 0.0 | BT083872.1 Zea mays full-length cDNA clone ZM_BFb0049I24 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001149534.1 | 1e-148 | SBP-transcription factor25 | ||||
Refseq | NP_001352585.1 | 1e-148 | SBP-transcription factor25 | ||||
Refseq | XP_008643717.1 | 1e-148 | squamosa promoter-binding-like protein 11 isoform X1 | ||||
Refseq | XP_008643719.1 | 1e-148 | squamosa promoter-binding-like protein 11 isoform X1 | ||||
Refseq | XP_008643720.1 | 1e-148 | squamosa promoter-binding-like protein 11 isoform X1 | ||||
Swissprot | A2YGR5 | 4e-71 | SPL12_ORYSI; Squamosa promoter-binding-like protein 12 | ||||
Swissprot | Q5Z818 | 4e-71 | SPL12_ORYSJ; Squamosa promoter-binding-like protein 12 | ||||
TrEMBL | A0A3L6EKM4 | 1e-148 | A0A3L6EKM4_MAIZE; Squamosa promoter-binding-like protein 12 | ||||
TrEMBL | C4IZ75 | 1e-150 | C4IZ75_MAIZE; Squamosa promoter-binding-like protein 11 | ||||
STRING | GRMZM2G414805_P05 | 1e-148 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G43270.3 | 3e-27 | squamosa promoter binding protein-like 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G414805_P06 |
Publications ? help Back to Top | |||
---|---|---|---|
|