PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G409974_P01
Common NameLOC100191412, ZEAMMB73_309593
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family ARR-B
Protein Properties Length: 669aa    MW: 72502 Da    PI: 6.3137
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G409974_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.5e-28223276155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+ Lt+e+v+SHLQkYRl
  GRMZM2G409974_P01 223 KPRVVWSIELHRKFVAAVNQL-GIDKAVPKRILELMNVEKLTRENVASHLQKYRL 276
                        79*******************.********************************8 PP

2Response_reg73.77.2e-25301381109
                        EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHH CS
       Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedaleal 90 
                        vl vdD+p+ +++l+++l++ +y +v ++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +ge + + + +
  GRMZM2G409974_P01  30 VLAVDDDPVCLKVLETLLRRCQY-HVITTNQAITALKLLRENRdmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGETKSVMKGI 119
                        799********************.999************99999********************87754.558******************* PP

                        HTTESEEEESS--HHHHHH CS
       Response_reg  91 kaGakdflsKpfdpeelvk 109
                          Ga d+l Kp+ +eel++
  GRMZM2G409974_P01 120 THGACDYLLKPVRIEELRN 138
                        *****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.6E-1917669IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.1E-4027157No hitNo description
SuperFamilySSF521726.55E-3527154IPR011006CheY-like superfamily
SMARTSM004481.1E-2928140IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.91129144IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-2230139IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.03E-2531143No hitNo description
PROSITE profilePS5129411.078220279IPR017930Myb domain
SuperFamilySSF466892.15E-19221280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-30221281IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-25223276IPR006447Myb domain, plants
PfamPF002494.3E-6225275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MLLGAAAARM EEKRVITGRE RDQFPVGMRV LAVDDDPVCL KVLETLLRRC QYHVITTNQA  60
ITALKLLREN RDMFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSVNG ETKSVMKGIT  120
HGACDYLLKP VRIEELRNIW QHVVRRKFSK RERSNLDVYK DFNRLPGADP CHSHGHGHGQ  180
TTAGASDQSG RIGRKRKEMH SDEEDDGEEN DFQEGDEPSA AKKPRVVWSI ELHRKFVAAV  240
NQLGIDKAVP KRILELMNVE KLTRENVASH LQKYRLYLKR LSAVASQQAS IVAAFGGRDP  300
FLHMGAFEGL QSYQPFAPCA ALSSFIPHHG SLGRTTAAAF GVPELAPAIT VQAAASNGMI  360
SHCAGDASKF QLSGIQENQQ PNLGQGSATS LGLPQLQQKW IQQETGDLSA VFSGSALANT  420
LSGALQRVAS SPLPPQELLE GVQTKVSAQP PITMASVSSE LVERTVGVSA NLQDSGISPQ  480
GTLPINDGFT ADKLQLQDPF DSNGGTNFSV NMPVCPSGSL TASSNAKGGA SSCSPVLLAP  540
DTGRHSNYLQ FGVAGNSGHD MNDIKQDHLH QGLSTGGFNH DFGTCMTEQT DPNVPYLMPQ  600
MKPNTLSSED KLKQRNIYDL GIPKLHGGFS SSSCNFDGLL NSMIKAEKDD LSFTDSDLGC  660
DFFPLGACI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-25219282164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.288230.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G409974
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). Functions as a response regulator in response to cytokinins (PubMed:22383541). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:22383541}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G409974_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0334950.0BT033495.1 Zea mays full-length cDNA clone ZM_BFb0295K12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008657992.10.0uncharacterized protein LOC100191412 isoform X1
SwissprotQ5SML50.0ORR22_ORYSJ; Two-component response regulator ORR22
TrEMBLA0A3L6D9J20.0A0A3L6D9J2_MAIZE; Two-component response regulator
TrEMBLK7VE330.0K7VE33_MAIZE; Two-component response regulator
STRINGGRMZM2G409974_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18563894
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-105response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]