PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G403620_P01
Common NameRS2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 370aa    MW: 41918.8 Da    PI: 10.0991
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G403620_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-14453148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                       r+rW +eEd  l  +v+q+G++ W++++++m+  + R +k+c +rw +yl
  GRMZM2G403620_P01  4 RQRWRPEEDAVLRAYVRQYGPREWHLVSQRMNvaLDRDAKSCLERWKNYL 53
                       89**********************************************97 PP

2Myb_DNA-binding36.41.2e-1159103147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  GRMZM2G403620_P01  59 KGSLTEEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                        6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.82153IPR017930Myb domain
SMARTSM007171.3E-11355IPR001005SANT/Myb domain
SuperFamilySSF466893.48E-21498IPR009057Homeodomain-like
CDDcd001673.19E-7653No hitNo description
Gene3DG3DSA:1.10.10.604.3E-20660IPR009057Homeodomain-like
PfamPF139215.0E-13767No hitNo description
PROSITE profilePS5129423.37554108IPR017930Myb domain
SMARTSM007172.8E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-1561102IPR009057Homeodomain-like
CDDcd001678.74E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0042803Molecular Functionprotein homodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MKERQRWRPE EDAVLRAYVR QYGPREWHLV SQRMNVALDR DAKSCLERWK NYLRPGIKKG  60
SLTEEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE LRDSRRPPPE  120
PSPDERGRYE WLLENFAEKL VGERPQQAAA APSPLLMAAP VLPPWLSSNA GPAAAAAAAV  180
AHPPPRPPSP SVTLSLASAA VAPGPPAPAP WMPDRAAADA APYGFPSPSQ HGGAAPPGMA  240
VVDGQALAEL AECCRELEEG RRAWAAHRRE AAWRLKRVEQ QLEMEREMRR REVWEEFEAK  300
MRTMRLEQAA AAERVERDHR EKVAELRRDA QVKEEKMAEQ WAAKHARVAK FVEQMGGCSR  360
SWSSATDMNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-157101798MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-157101798C-Myb DNA-Binding Domain
1msf_C6e-157101798C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.55810.0ear| embryo| meristem| pericarp| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G403620
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in lateral organ promordia. {ECO:0000269|PubMed:10102816, ECO:0000269|PubMed:16243907}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for normal cell differentiation. Interacts directly with asymmetric leaves 2 (AS2) to repress the knox homeobox genes. {ECO:0000269|PubMed:10102816, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:9655808}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G403620_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9S7B2
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1434470.0AF143447.1 Zea mays rough sheath 2 (rs2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105509.10.0protein rough sheath 2
SwissprotQ9S7B20.0RS2_MAIZE; Protein rough sheath 2
TrEMBLA0A1R3LYQ00.0A0A1R3LYQ0_MAIZE; Protein rough sheath 2
STRINGGRMZM2G403620_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Representative plantOGRP50961421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.12e-68MYB family protein
Publications ? help Back to Top
  1. Timmermans MC,Hudson A,Becraft PW,Nelson T
    ROUGH SHEATH2: a Myb protein that represses knox homeobox genes in maize lateral organ primordia.
    Science, 1999. 284(5411): p. 151-3
    [PMID:10102816]
  2. Tsiantis M,Schneeberger R,Golz JF,Freeling M,Langdale JA
    The maize rough sheath2 gene and leaf development programs in monocot and dicot plants.
    Science, 1999. 284(5411): p. 154-6
    [PMID:10102817]
  3. Theodoris G,Inada N,Freeling M
    Conservation and molecular dissection of ROUGH SHEATH2 and ASYMMETRIC LEAVES1 function in leaf development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(11): p. 6837-42
    [PMID:12750468]
  4. Phelps-Durr TL,Thomas J,Vahab P,Timmermans MC
    Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis.
    Plant Cell, 2005. 17(11): p. 2886-98
    [PMID:16243907]
  5. Schneeberger R,Tsiantis M,Freeling M,Langdale JA
    The rough sheath2 gene negatively regulates homeobox gene expression during maize leaf development.
    Development, 1998. 125(15): p. 2857-65
    [PMID:9655808]