PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G346706_P01
Common NameGRAS6, ZEAMMB73_496542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 627aa    MW: 70612.1 Da    PI: 7.267
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G346706_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.23.8e-1112536232374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        + lL++cA+a+ss+++  a++lL+++++++sp+gd  qRla yf+ AL+ar a+++s++ + l +++ts   +++ l+a++l   ++P+ ++
  GRMZM2G346706_P01 253 RGLLIQCAQAISSNNHPFASELLKKIRHHSSPYGDGSQRLAVYFADALEARAAGTGSQINQRLVVKRTS---VTDMLKAYRLSIAACPFGRV 341
                        679****************************************************************99...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        ++  aN++I++ + +  rvHiiDf+i+ G+QWp+L+q La+R++gpp+lRiTg++ pe+g    +++eetg+rLa++A+ ++vpf+++  va
  GRMZM2G346706_P01 342 AYYFANKTIVDVLGSRPRVHIIDFGIMFGFQWPSLIQRLAKREGGPPQLRITGIDVPETGfrPCKQIEETGKRLAEYARMFNVPFQYQS-VA 432
                        **********************************************************999999*************************.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eak 274
                        +r+e++ + +L++ ++E+l+Vn+ +++++l de+ +++s+rd+vL+++k+++P+v++    +  h+s+ Fl rf eal +ys+ fd+l ++ 
  GRMZM2G346706_P01 433 SRWESIYIADLNIGRDEVLIVNCLHKMKNLGDETEDIDSARDRVLRIMKRMNPDVLITGVMNGLHSSPFFLPRFREALFFYSSQFDMLnSTV 524
                        ****************************************************************************************7777 PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        +++++e+ri++Er llg ++ nvvacegaer+er e++++W++r+ +aGFk++p+++++ k      + +++d + ++e+sg+l++gWk+r 
  GRMZM2G346706_P01 525 VHQNHEARIMIERDLLGADVFNVVACEGAERIERPESYKQWQARILKAGFKKLPVDQTILKGSVDRKELYHGD-FVIDEDSGWLLQGWKGRI 615
                        78888******************************************************************88.****************** PP

               GRAS 367 LvsvSaWr 374
                        + ++S+W+
  GRMZM2G346706_P01 616 MHALSSWK 623
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.765226604IPR005202Transcription factor GRAS
PfamPF035141.3E-108253623IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MDNLEYCEIN SDITLNYITQ ILMEESADEN ISAYKHHDAL QAMEKPFYDI LGKAYPSSSK  60
QTMVNSGSQS GLPDDINNSH HDLERSGNSV SDLLRGRKGV RSIGIDGGSE LCDVALQFNR  120
IAEEAKKFVP SIGNLVVDPE SNDLSSSKEA NGSAIGQHSN QTNKIRSYPH VDLKLVEGRN  180
SKYSAISTSE IIRNELFDRV LLSDEQYLCD VAHLREMAKE ANINLQYVQN TGSAQGKQKP  240
QSKKQEKEAV DLRGLLIQCA QAISSNNHPF ASELLKKIRH HSSPYGDGSQ RLAVYFADAL  300
EARAAGTGSQ INQRLVVKRT SVTDMLKAYR LSIAACPFGR VAYYFANKTI VDVLGSRPRV  360
HIIDFGIMFG FQWPSLIQRL AKREGGPPQL RITGIDVPET GFRPCKQIEE TGKRLAEYAR  420
MFNVPFQYQS VASRWESIYI ADLNIGRDEV LIVNCLHKMK NLGDETEDID SARDRVLRIM  480
KRMNPDVLIT GVMNGLHSSP FFLPRFREAL FFYSSQFDML NSTVVHQNHE ARIMIERDLL  540
GADVFNVVAC EGAERIERPE SYKQWQARIL KAGFKKLPVD QTILKGSVDR KELYHGDFVI  600
DEDSGWLLQG WKGRIMHALS SWKPKDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-502376254381Protein SCARECROW
5b3h_A1e-502376253380Protein SCARECROW
5b3h_D1e-502376253380Protein SCARECROW
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G346706
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G346706_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280160.0KJ728016.1 Zea mays clone pUT6152 GRAS transcription factor (GRAS6) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656556.10.0scarecrow-like protein 9
TrEMBLA0A3L6DLZ90.0A0A3L6DLZ9_MAIZE; Scarecrow-like protein 9
TrEMBLK7V6270.0K7V627_MAIZE; GRAS transcription factor
STRINGGRMZM2G346706_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-159GRAS family protein