PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G334225_P02 | ||||||||
Common Name | LOC100282219 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 175aa MW: 20340.4 Da PI: 9.2462 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.1 | 2.3e-28 | 33 | 82 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs++++l +s GRMZM2G334225_P02 33 KRIENNTNRQVTFSKRRNGLIKKAYELSVLCDIDIALIMFSPSNRLSHFS 82 79********************************************9997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.436 | 25 | 85 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.4E-38 | 25 | 84 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.65E-35 | 26 | 99 | No hit | No description |
SuperFamily | SSF55455 | 1.57E-30 | 26 | 107 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-26 | 27 | 47 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 27 | 81 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.3E-26 | 34 | 81 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-26 | 47 | 62 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-26 | 62 | 83 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MSICIPGSPL QFACNLGGDR LHSIMGRVKL QIKRIENNTN RQVTFSKRRN GLIKKAYELS 60 VLCDIDIALI MFSPSNRLSH FSGRRRIEDV ITRYINLPEH DRGGVVRNRE YLMKMLAKLK 120 CEGNIAEQLT PNKEPINSNV EELQQEIKTY QHQMEVLKEQ LRSDNIDVDE RFRDV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
6byy_B | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
6byy_C | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
6byy_D | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
6bz1_A | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
6bz1_B | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
6bz1_C | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
6bz1_D | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G334225 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G334225_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT060896 | 0.0 | BT060896.1 Zea mays full-length cDNA clone ZM_BFb0067L07 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001148603.1 | 6e-95 | MADS-box protein AGL66 | ||||
Swissprot | Q9LM46 | 1e-52 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
TrEMBL | A0A3L6E9M3 | 1e-112 | A0A3L6E9M3_MAIZE; Agamous-like MADS-box protein AGL66 | ||||
STRING | GRMZM2G334225_P01 | 1e-115 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22130.1 | 5e-55 | AGAMOUS-like 104 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G334225_P02 |
Publications ? help Back to Top | |||
---|---|---|---|
|