PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G330475_P01 | ||||||||
Common Name | ZEAMMB73_558799 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 357aa MW: 38887.8 Da PI: 4.6026 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.2 | 8.2e-18 | 54 | 101 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT +Ed llv++++ +G g+W++ ar g++Rt+k+c++rw++yl GRMZM2G330475_P01 54 RGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLRRTGKSCRLRWLNYL 101 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.2 | 2.8e-16 | 107 | 150 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++ GRMZM2G330475_P01 107 RGNITVEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 150 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.708 | 49 | 101 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.73E-30 | 52 | 148 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-14 | 53 | 103 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.3E-16 | 54 | 101 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-21 | 55 | 108 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.24E-12 | 56 | 101 | No hit | No description |
PROSITE profile | PS51294 | 23.666 | 102 | 156 | IPR017930 | Myb domain |
SMART | SM00717 | 5.6E-15 | 106 | 154 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.2E-15 | 107 | 150 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.7E-23 | 109 | 154 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.46E-12 | 111 | 150 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 357 aa Download sequence Send to blast |
MDMDMGMTMV GLDEDLDQVL AAISSAGSSA TSAPAATGGS SEDDETTAAT ELRRGPWTVD 60 EDILLVNYIA AHGEGRWNSL ARSAGLRRTG KSCRLRWLNY LRPDVRRGNI TVEEQLLILE 120 LHSRWGNRWS KIAQHLPGRT DNEIKNYWRT RVQKHARRLR CDANSAQFRH LWMPRLLERA 180 QDLQQPAAAT VPAAVAQAAP ATTTTSAPPP ACYYNYYYDD HHHLAHQQGA LHQYYSETGS 240 PDDASSALRP PSSSLTADDG AARYAAAYET SANDLQVLHQ CGADAGSGPT TTTEDDVFAG 300 TTWSDLLATA TATGPDGDDS SSSMIGLQME DFGFGLGDLA DDGLWSLDDL FCFQQLC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-26 | 51 | 154 | 1 | 103 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G330475 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G330475_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT084980 | 1e-146 | BT084980.1 Zea mays full-length cDNA clone ZM_BFb0220H11 mRNA, complete cds. | |||
GenBank | KJ726902 | 1e-146 | KJ726902.1 Zea mays clone pUT3447 MYB transcription factor (MYB134) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020398348.1 | 0.0 | transcription factor MYB2 | ||||
TrEMBL | A0A1D6FUZ6 | 0.0 | A0A1D6FUZ6_MAIZE; Putative MYB DNA-binding domain superfamily protein | ||||
STRING | GRMZM2G330475_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP198 | 38 | 330 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G48000.1 | 1e-77 | myb domain protein 112 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G330475_P01 |