PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G322490_P01
Common NameZEAMMB73_610040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 197aa    MW: 21931.2 Da    PI: 9.2879
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G322490_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.3e-15450148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       + +WT+eEd  l + v+++G+ +W++I+  +  gR +k+c++rw ++l
  GRMZM2G322490_P01  4 KSAWTKEEDAVLREQVRLHGPQNWSAISGALL-GRNPKSCRLRWCQHL 50
                       579****************************9.***********9986 PP

2Myb_DNA-binding47.93.1e-1559101347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++T++Ede++v   +q++++ W+tIa  ++ gRt++ +k+rw+++
  GRMZM2G322490_P01  59 PFTPQEDEKIVVFYRQYPNK-WATIAGFLP-GRTDNAIKNRWHSV 101
                        79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.645154IPR017930Myb domain
SuperFamilySSF466893.88E-29298IPR009057Homeodomain-like
SMARTSM007175.7E-14352IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-18352IPR009057Homeodomain-like
PfamPF002491.6E-13450IPR001005SANT/Myb domain
CDDcd001676.12E-13650No hitNo description
SMARTSM007172.0E-1156104IPR001005SANT/Myb domain
PROSITE profilePS5129415.84658106IPR017930Myb domain
CDDcd001679.50E-1159102No hitNo description
PfamPF002491.2E-1259102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-1859102IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006340anatomyadult vascular leaf
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009066anatomyanther
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MKKKSAWTKE EDAVLREQVR LHGPQNWSAI SGALLGRNPK SCRLRWCQHL SPVVDTARPF  60
TPQEDEKIVV FYRQYPNKWA TIAGFLPGRT DNAIKNRWHS VLGKVYQQLQ QQQRVAAAGR  120
RLLDEISPLA LFPLTPGGVK TFGRGIVSVL HQQPTWVDLS GECLKLFPLV AGDLVRGSDA  180
SEAAAMDVDC STDEALV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A1e-2741042101MYB3
3zqc_D1e-2741042101MYB3
3zqc_G1e-2741042101MYB3
3zqc_J1e-2741042101MYB3
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G322490
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G322490_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008655885.21e-145transcription factor MYB56
SwissprotQ9SN124e-34MYB77_ARATH; Transcription factor MYB77
TrEMBLK7VS031e-144K7VS03_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G322490_P011e-145(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-36myb domain protein 77
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]