PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G320549_P01

Common Name

Zm.155436

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9242.88 Da PI: 11.2657

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G320549_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	85.4	3.3e-27	22	71	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+ rqv fskRr g++KKA+ELS LCdaeva+i+fs+ gklyey+s GRMZM2G320549_P01 22 RIEDRVSRQVRFSKRRSGLFKKAFELSLLCDAEVALIVFSPAGKLYEYAS 71 8***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.9E-33	13	72	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.296	13	73	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.26E-34	14	80	No hit	No description
SuperFamily	SSF55455	1.18E-27	15	79	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-28	15	35	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.3E-26	22	69	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-28	35	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-28	50	71	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MAARIGADGK AMARRGRVEL RRIEDRVSRQ VRFSKRRSGL FKKAFELSLL CDAEVALIVF 60 SPAGKLYEYA STRVKFVLEH L

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3kov_B	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3kov_I	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3kov_J	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3mu6_A	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3mu6_B	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3mu6_C	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3mu6_D	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3p57_A	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3p57_B	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3p57_C	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3p57_D	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3p57_I	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
3p57_J	2e-19	15	78	2	65	Myocyte-specific enhancer factor 2A
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G320549

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed. {ECO:0000269\|PubMed:10382970}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269\|PubMed:17951465}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G320549_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF184819	1e-91	KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008673731.1	5e-45	MADS-box transcription factor 51
Swissprot	Q9XJ61	6e-32	MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBL	A0A1D6MLR7	1e-43	A0A1D6MLR7_MAIZE; MADS-box transcription factor 56
STRING	GRMZM2G320549_P02	2e-44	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45660.1	1e-27	AGAMOUS-like 20

Link Out ? help Back to Top
Phytozome	GRMZM2G320549_P01

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465]