PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G314546_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HB-PHD
Protein Properties Length: 1577aa    MW: 172331 Da    PI: 6.8063
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G314546_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.81.4e-11803849652
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        ++ +e ++ L+ +Fek++yps+e++e L+++lgLt +qV+ WF   R
  GRMZM2G314546_P01 803 KYDPEVTQKLKVHFEKDPYPSRETKENLSEELGLTFNQVSKWFSSTR 849
                        678999*************************************8776 PP

2Homeobox314.4e-10104810871352
                         HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52  
                         + L+e+Fek++yp ++++e LA++lgLt +q++ WF   R
  GRMZM2G314546_P01 1048 QKLKEHFEKDPYPCRATKESLAQELGLTFNQISKWFSGTR 1087
                         78**********************************8665 PP

3PHD42.61.4e-14472526150
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCke 50 
                        +C++Cg+   +++++++lCdg C++ fH++Cl+++l +ee+p g   wlC+ C +
  GRMZM2G314546_P01 472 FCAICGSkdVTSQNDIILCDGaCDRGFHQNCLSPPLLTEEIPPGdeGWLCPACVC 526
                        7******76667********66********************9999*******87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.76E-16463529IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.2E-14468527IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.217470527IPR019787Zinc finger, PHD-finger
PfamPF006289.9E-12472526IPR019787Zinc finger, PHD-finger
SMARTSM002493.8E-12472525IPR001965Zinc finger, PHD-type
CDDcd155045.87E-28472524No hitNo description
PROSITE patternPS013590473524IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.005795855IPR001356Homeobox domain
SMARTSM003898.0E-12798859IPR001356Homeobox domain
SuperFamilySSF466893.17E-11799859IPR009057Homeodomain-like
CDDcd000869.87E-12802853No hitNo description
PfamPF000465.7E-9803849IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-12803859IPR009057Homeodomain-like
PROSITE profilePS5007113.03810331093IPR001356Homeobox domain
SMARTSM003892.7E-1110351097IPR001356Homeobox domain
SuperFamilySSF466891.41E-1010351092IPR009057Homeodomain-like
CDDcd000866.94E-1110391091No hitNo description
PfamPF000461.3E-710471087IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-1110481092IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 1577 aa     Download sequence    Send to blast
MGRKGSEVSP SKRYPLRSAH SSGRVLRSAL ANNNKDSEPL NAAAATQAAV KKRSGNQLDS  60
PNSTVRLLRS TSKNKDEAHS GPLNDRIIDK PAANKRKHAN PSQVGSPSSS VRVLRSAIKN  120
KDMARSEPQS DRTAGEAATN KRKNANSSKV GSLSSGLSVL RSASKAKDET CIKPLNDSAA  180
VEPASSKRKC TSPSKVGSPS NSVRVLRSTS KYKNETCTEP LNDSGAVEPA ANRRKGVSRS  240
KEGSPNSSVR VLRSASNNKI DVSIEPLNNS TTGQPAAKRR KNGSSFKSSA RVLCSTSERA  300
NEASSEPLND STAAQPAARK KKGGAMPKTD NPKIGVRVLR SASGKKNETC TEPVNGSTSA  360
EPTVTKKRNC KPSKDRSPKK DYLKICQRIK YILNRMKYEQ AFIQAYASEG WKGQSLEKIR  420
PEKELERAKA EILQCKLRIR EAFRNMDSLL SKGKLEESLF DSAGQISSED IFCAICGSKD  480
VTSQNDIILC DGACDRGFHQ NCLSPPLLTE EIPPGDEGWL CPACVCKADY IDALNELQGS  540
KLSIHDSWVK VFPEAASTAN GSKQVDASDL LPDHIKDSAN LALVGTHMVN EIRFSEEDDS  600
KADDLGLPSE DSGDGDFDPA GPDSSEDQND GLNSEESDFT SDSDYFCAEI AKSCGQDEVS  660
ASPLSNVINR TDRMKLRAYS RRSNEENHNH AFMDMELEQD IVLPVPSRRQ VERLDYKKLY  720
DEAYEEESSN SSDEEEWSGK ELLEGSGTDS LDERLRPVKR CSRRAPAGQQ NNELTPQSRP  780
HGSNSEQKTE VLRSNGSSST GRKYDPEVTQ KLKVHFEKDP YPSRETKENL SEELGLTFNQ  840
VSKWFSSTRH YSRVASAKKE MHPDSHTCEN NDETTVDSMQ AKQPNAGVME KLTGDRNGIV  900
PEKPMVQDNL NQGAMEKLTR DKNDIVPEKP VMQSSLNQCN NEDIPLSGTE IEMESYEQES  960
SDSSDEEWSI LSTPRKTRLQ DHGKSSVTES LRSAKRCSRR APAREQNNER IQSEQLHGSA  1020
SEQQTEFLRS NVSSGKVSKY HFGPIVSQKL KEHFEKDPYP CRATKESLAQ ELGLTFNQIS  1080
KWFSGTRHYS RDAVAKNQKR PGENTTVNNN STTFDDIQVI EPNVGLIDKP AADVNDMISE  1140
KLMVQINLNE GIEEDIPPSQ YARCEEKITM TPAAISREAG LPGYGPGPGE NFLQVSSRNT  1200
SCEQSVILAP TAIAREVGPP GYATGENQGN GAPWNTSYER RLFMNPVTSS RAVSPPGYGP  1260
EESRGSGISW NTSSEQILFM SPTTISRELG PPGYGPREDQ CSGTSWNASC ELGVFMSPVT  1320
TSREDSPPGY GPRENQENDN MRCELRMFTS PTTISREVGP PGYELTGKNK GNGASCTTNY  1380
QQGAFTSPEA FPREACPPGF VSGENQGNDT PWYMSSKQMA FTSPTTNPRV GPPGYGQENQ  1440
GSRVSWNTSY EQGVFMSSTN ISREAGPPGY GPGESQGNIT SWISTGGQRM FTGPSTIPNE  1500
VGQQGYGPSG IPGTDGSRSM DLKAFPPGYG PAGENQGGGA SGSVISPQAR SAENVEFSDD  1560
ARKKAIQREL RRRQKFR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1140.0cell culture| embryo| meristem| ovary| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G314546
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the outer layers of globular embryos. {ECO:0000269|PubMed:15094187}.
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems, panicle and seeds. {ECO:0000269|PubMed:21951842}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor involved in the regulation of gibberrelin (GA) signaling. Binds to the 5'-GATC-3' motif of HD16/EL1 promoter. Functions as a positive regulator of GA signaling by suppressing the expression of HD16/EL1, a negative regulator of GA signaling. {ECO:0000269|PubMed:21951842}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G314546_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:21951842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX897600.0X89760.1 Z.mays mRNA for homeobox 2a protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001296140.10.0homeobox 3
RefseqXP_008673434.10.0homeobox 3 isoform X1
RefseqXP_008673435.10.0homeobox 3 isoform X1
SwissprotQ8H9910.0HAZ1_ORYSJ; Homeobox protein HAZ1
TrEMBLA0A1D6NC340.0A0A1D6NC34_MAIZE; Homeobox3
STRINGGRMZM2G314546_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Representative plantOGRP18301539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-82Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wen BQ,Xing MQ,Zhang H,Dai C,Xue HW
    Rice homeobox transcription factor HOX1a positively regulates gibberellin responses by directly suppressing EL1.
    J Integr Plant Biol, 2011. 53(11): p. 869-78
    [PMID:21951842]
  3. Klinge B,Uberlacker B,Korfhage C,Werr W
    ZmHox: a novel class of maize homeobox genes.
    Plant Mol. Biol., 1996. 30(3): p. 439-53
    [PMID:8605297]