PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G308034_P02
Common NameZm.41086
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 61aa    MW: 6589.46 Da    PI: 8.2253
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G308034_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.13e-111449137
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                       +g+WT+eEd +l+ +   +G+g+W+ ++++ g  R +
  GRMZM2G308034_P02 14 KGPWTPEEDAKLLAYTSTHGTGNWTNVPQRAG-DRAA 49
                       79*****************************9.8866 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-14546IPR009057Homeodomain-like
SuperFamilySSF466892.51E-10848IPR009057Homeodomain-like
PROSITE profilePS5129413.165961IPR017930Myb domain
PfamPF002496.1E-101449IPR001005SANT/Myb domain
CDDcd001673.99E-81647No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0025541anatomybundle sheath cell
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGPWTPE EDAKLLAYTS THGTGNWTNV PQRAGDRAAV HHAFCCFVCG  60
S
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G308034
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During anther development, first confined to meiocytes, tapetal and middle layer cells. At the microspore stage, mainly expressed in the tapetum and microspores. Later observed in developing pollen grains. {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}.
UniprotTISSUE SPECIFICITY: Inflorescences-specific (PubMed:18397379). Accumulates in anthers, especially in tapetum and meiocytes/microsporocytes and microspores during anther development (PubMed:17666023, PubMed:18397379). {ECO:0000269|PubMed:17666023, ECO:0000269|PubMed:18397379}.
Functional Description ? help Back to Top
Source Description
UniProtRequired for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G308034_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0854912e-68BT085491.1 Zea mays full-length cDNA clone ZM_BFc0020H06 mRNA, complete cds.
GenBankBT0862662e-68BT086266.1 Zea mays full-length cDNA clone ZM_BFc0140J15 mRNA, complete cds.
GenBankEU9670892e-68EU967089.1 Zea mays clone 299414 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465411.12e-25myb-related protein Zm38
SwissprotQ9LSI79e-19MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A1Z5S9Y74e-24A0A1Z5S9Y7_SORBI; Uncharacterized protein
TrEMBLA0A3L6S2K34e-24A0A3L6S2K3_PANMI; DNA binding protein
TrEMBLC4J6198e-26C4J619_MAIZE; Uncharacterized protein
STRINGPavir.Db01456.1.p8e-25(Panicum virgatum)
STRINGSb01g038250.17e-25(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-21MYB family protein
Publications ? help Back to Top
  1. Tsugama D, et al.
    A putative MYB35 ortholog is a candidate for the sex-determining genes in Asparagus officinalis.
    Sci Rep, 2017. 7: p. 41497
    [PMID:28176806]
  2. Lou Y, et al.
    Positive regulation of AMS by TDF1 and the formation of a TDF1-AMS complex are required for anther development in Arabidopsis thaliana.
    New Phytol., 2018. 217(1): p. 378-391
    [PMID:28940573]
  3. Li DD,Xue JS,Zhu J,Yang ZN
    Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana.
    Front Plant Sci, 2017. 8: p. 1559
    [PMID:28955355]