PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G303465_P01 | ||||||||
Common Name | LOC100285917 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 112aa MW: 12332 Da PI: 5.2473 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 179 | 4.4e-56 | 17 | 109 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+yveplk+yl+ky+e GRMZM2G303465_P01 17 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYVEPLKIYLQKYKE 108 69*****************************************************************************************9 PP NF-YB 93 l 93 + GRMZM2G303465_P01 109 I 109 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.3E-53 | 15 | 108 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.48E-39 | 20 | 109 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.8E-29 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.0E-23 | 51 | 69 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.0E-23 | 70 | 88 | No hit | No description |
PRINTS | PR00615 | 8.0E-23 | 89 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MADDGGSHEG SGGGGGVREQ DRFLPIANIS RIMKKAVPAN GKIAKDAKET LQECVSEFIS 60 FVTSEASDKC QKEKRKTING DDLLWAMATL GFEEYVEPLK IYLQKYKEIF VG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 9e-49 | 16 | 108 | 1 | 93 | NF-YB |
4awl_B | 8e-49 | 16 | 108 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 8e-49 | 16 | 108 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.8797 | 0.0 | cell culture| ear| embryo| endosperm| meristem| pericarp| root| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G303465 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14617083}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G303465_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT068277 | 0.0 | BT068277.1 Zea mays full-length cDNA clone ZM_BFb0103M17 mRNA, complete cds. | |||
GenBank | EU975758 | 0.0 | EU975758.1 Zea mays clone 499728 nuclear transcription factor Y subunit B-3 mRNA, complete cds. | |||
GenBank | HQ858725 | 0.0 | HQ858725.1 Zea mays clone UT1393 CCAAT-HAP3 transcription factor mRNA, partial cds. | |||
GenBank | KJ726803 | 0.0 | KJ726803.1 Zea mays clone pUT3050 CCAAT-HAP3 transcription factor (CA3P1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001278514.1 | 1e-75 | uncharacterized protein LOC100285917 | ||||
Swissprot | Q5QMG3 | 7e-62 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | A0A096T4I5 | 5e-77 | A0A096T4I5_MAIZE; Nuclear transcription factor Y subunit B-8 | ||||
STRING | GRMZM2G303465_P04 | 4e-75 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.8 | 2e-60 | nuclear factor Y, subunit B1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G303465_P01 |