PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G179885_P04 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 75aa MW: 8274.41 Da PI: 4.682 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 60.7 | 4.8e-19 | 27 | 73 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrFhPtdeelvv+yLkkk+++ +l++ +i+evd+yk++Pw+Lp GRMZM2G179885_P04 27 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-AIIAEVDLYKFDPWELP 73 79****************************.88**************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.35E-21 | 24 | 74 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 23.053 | 27 | 75 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.9E-9 | 28 | 63 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0045995 | Biological Process | regulation of embryonic development | ||||
GO:0048317 | Biological Process | seed morphogenesis | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MRSMESTDSS SGELPPPQKQ PSSAPDLPPG FRFHPTDEEL VVHYLKKKAA SVPLPVAIIA 60 EVDLYKFDPW ELPGT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-21 | 18 | 73 | 6 | 61 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G179885 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00361 | DAP | Transfer from AT3G15510 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G179885_P04 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT054558 | 1e-124 | BT054558.1 Zea mays full-length cDNA clone ZM_BFc0156L17 mRNA, complete cds. | |||
GenBank | KP729886 | 1e-124 | KP729886.1 Zea mays voucher B100 NAC transcription factor gene, complete cds. | |||
GenBank | KP729887 | 1e-124 | KP729887.1 Zea mays voucher ZN6 NAC transcription factor gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002463039.1 | 2e-44 | NAC transcription factor NAM-B2 | ||||
Swissprot | A2YMR0 | 2e-34 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
TrEMBL | C5XBN1 | 5e-43 | C5XBN1_SORBI; Uncharacterized protein | ||||
STRING | Sb02g036620.1 | 8e-44 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 4e-28 | NAC domain containing protein 25 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G179885_P04 |